Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0H2RWE0

Protein Details
Accession A0A0H2RWE0    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
42-61MSLAPRRRRIAKPHVRICRFHydrophilic
NLS Segment(s)
PositionSequence
48-52RRRIA
Subcellular Location(s) plas 9, mito 7, E.R. 4, cyto_mito 4, extr 3
Family & Domain DBs
Amino Acid Sequences MLEFLLHAFTSLTPCLLPCLLFRLLVCSPSRSPSFSCFYKLMSLAPRRRRIAKPHVRICRFSSRRTRL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.12
3 0.12
4 0.12
5 0.09
6 0.14
7 0.14
8 0.14
9 0.14
10 0.17
11 0.17
12 0.2
13 0.2
14 0.19
15 0.19
16 0.22
17 0.23
18 0.2
19 0.21
20 0.22
21 0.25
22 0.23
23 0.26
24 0.23
25 0.23
26 0.23
27 0.22
28 0.2
29 0.23
30 0.31
31 0.36
32 0.44
33 0.51
34 0.54
35 0.6
36 0.64
37 0.66
38 0.69
39 0.71
40 0.73
41 0.75
42 0.81
43 0.79
44 0.77
45 0.75
46 0.75
47 0.68
48 0.67