Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0H2R6T8

Protein Details
Accession A0A0H2R6T8   
Localization Confidence High
Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
6-32SFDDKVPLTRRRKEKGARSIKLNRAEFHydrophilic
NLS Segment(s)
PositionSequence
15-23RRRKEKGAR
Subcellular Location(s) nucl 23, mito 2, cyto 2, cyto_mito 2
Family & Domain DBs
Amino Acid Sequences MRIHTSFDDKVPLTRRRKEKGARSIKLNRAEFEEVYEAHFHSNLRIKNVVKMEDLSPSNFCVAILAQPLNDMSSTNPGKERSRRSLVVIRRDENAPESLVGLRNFLLCHAQRRRAIEWTEPNASSYPQRDCDNQGLAIKTGIVLGYHCGVGYSILAKKLSSDIRVQVLSAVCNRINASCDEPITRHTSVNSTTMQCLLASLGPIQFSHQSTAQKMSASITYINSPFDFEITINHGNCFVPGLNEVYARSWVEFAKNVIVGALASYVKGTYAIKSVDRMEGSTAVYIRQPNSNNTPGLGYKLKCEILNGQPYYSVNQLPFYECD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.65
3 0.66
4 0.76
5 0.79
6 0.81
7 0.83
8 0.85
9 0.82
10 0.82
11 0.85
12 0.83
13 0.82
14 0.75
15 0.66
16 0.61
17 0.59
18 0.49
19 0.43
20 0.38
21 0.29
22 0.28
23 0.28
24 0.21
25 0.18
26 0.19
27 0.15
28 0.18
29 0.25
30 0.25
31 0.28
32 0.33
33 0.33
34 0.39
35 0.44
36 0.41
37 0.36
38 0.36
39 0.32
40 0.33
41 0.33
42 0.28
43 0.25
44 0.23
45 0.22
46 0.19
47 0.18
48 0.12
49 0.11
50 0.11
51 0.13
52 0.13
53 0.11
54 0.12
55 0.12
56 0.12
57 0.11
58 0.09
59 0.07
60 0.15
61 0.17
62 0.18
63 0.21
64 0.24
65 0.31
66 0.39
67 0.46
68 0.46
69 0.52
70 0.52
71 0.55
72 0.6
73 0.6
74 0.63
75 0.61
76 0.54
77 0.5
78 0.49
79 0.44
80 0.38
81 0.32
82 0.22
83 0.16
84 0.15
85 0.14
86 0.16
87 0.15
88 0.14
89 0.12
90 0.12
91 0.12
92 0.12
93 0.16
94 0.14
95 0.23
96 0.28
97 0.34
98 0.37
99 0.42
100 0.44
101 0.45
102 0.46
103 0.44
104 0.46
105 0.44
106 0.44
107 0.39
108 0.38
109 0.33
110 0.31
111 0.26
112 0.22
113 0.2
114 0.19
115 0.21
116 0.22
117 0.25
118 0.28
119 0.27
120 0.25
121 0.25
122 0.22
123 0.21
124 0.19
125 0.15
126 0.11
127 0.09
128 0.07
129 0.05
130 0.04
131 0.05
132 0.05
133 0.05
134 0.05
135 0.05
136 0.05
137 0.05
138 0.05
139 0.06
140 0.06
141 0.08
142 0.08
143 0.08
144 0.09
145 0.12
146 0.13
147 0.13
148 0.14
149 0.15
150 0.17
151 0.17
152 0.16
153 0.15
154 0.14
155 0.13
156 0.13
157 0.13
158 0.11
159 0.12
160 0.12
161 0.1
162 0.12
163 0.12
164 0.14
165 0.12
166 0.13
167 0.13
168 0.13
169 0.15
170 0.19
171 0.19
172 0.17
173 0.16
174 0.18
175 0.19
176 0.21
177 0.21
178 0.17
179 0.16
180 0.17
181 0.16
182 0.14
183 0.12
184 0.1
185 0.08
186 0.07
187 0.07
188 0.07
189 0.07
190 0.07
191 0.09
192 0.11
193 0.11
194 0.13
195 0.16
196 0.18
197 0.19
198 0.23
199 0.23
200 0.2
201 0.2
202 0.19
203 0.16
204 0.16
205 0.15
206 0.12
207 0.14
208 0.14
209 0.15
210 0.14
211 0.14
212 0.12
213 0.12
214 0.11
215 0.08
216 0.1
217 0.14
218 0.19
219 0.18
220 0.18
221 0.19
222 0.18
223 0.18
224 0.18
225 0.12
226 0.09
227 0.09
228 0.12
229 0.12
230 0.12
231 0.13
232 0.13
233 0.15
234 0.14
235 0.13
236 0.12
237 0.12
238 0.14
239 0.15
240 0.15
241 0.17
242 0.16
243 0.16
244 0.14
245 0.13
246 0.11
247 0.09
248 0.1
249 0.06
250 0.06
251 0.06
252 0.06
253 0.06
254 0.08
255 0.08
256 0.08
257 0.12
258 0.14
259 0.15
260 0.18
261 0.2
262 0.24
263 0.24
264 0.23
265 0.22
266 0.22
267 0.21
268 0.21
269 0.19
270 0.16
271 0.18
272 0.2
273 0.2
274 0.24
275 0.26
276 0.3
277 0.37
278 0.41
279 0.39
280 0.37
281 0.39
282 0.33
283 0.36
284 0.36
285 0.29
286 0.28
287 0.33
288 0.34
289 0.31
290 0.33
291 0.34
292 0.36
293 0.45
294 0.43
295 0.38
296 0.38
297 0.39
298 0.39
299 0.36
300 0.31
301 0.22
302 0.25
303 0.26