Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0H2SHY2

Protein Details
Accession A0A0H2SHY2    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
122-144GHKVCTKCFKKALRKIRCCPMCHHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20, cyto_nucl 15, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR018957  Znf_C3HC4_RING-type  
IPR001841  Znf_RING  
IPR013083  Znf_RING/FYVE/PHD  
Gene Ontology GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF00097  zf-C3HC4  
PROSITE View protein in PROSITE  
PS50089  ZF_RING_2  
Amino Acid Sequences MSHHYKNYDSPNDGITCTIDKCRCKSRFRIRALPSNRPQEPPCEPEYHVGPPDYVGSNVLYYYGPQYSAYAERPVGEPSTSNLPLTASTSHPPNALGPPGIPCAKCPLCKRLVTDMSTGPCGHKVCTKCFKKALRKIRCCPMCHRATCYDELIRSFP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.27
3 0.22
4 0.2
5 0.26
6 0.28
7 0.31
8 0.36
9 0.45
10 0.5
11 0.55
12 0.64
13 0.68
14 0.71
15 0.75
16 0.8
17 0.76
18 0.79
19 0.79
20 0.79
21 0.75
22 0.75
23 0.69
24 0.64
25 0.58
26 0.55
27 0.53
28 0.47
29 0.43
30 0.37
31 0.36
32 0.34
33 0.36
34 0.33
35 0.3
36 0.26
37 0.22
38 0.19
39 0.19
40 0.17
41 0.13
42 0.11
43 0.09
44 0.09
45 0.09
46 0.09
47 0.07
48 0.07
49 0.08
50 0.07
51 0.07
52 0.07
53 0.08
54 0.09
55 0.11
56 0.12
57 0.12
58 0.12
59 0.12
60 0.13
61 0.13
62 0.12
63 0.1
64 0.09
65 0.09
66 0.15
67 0.14
68 0.13
69 0.12
70 0.12
71 0.12
72 0.13
73 0.13
74 0.1
75 0.11
76 0.13
77 0.13
78 0.13
79 0.14
80 0.13
81 0.13
82 0.12
83 0.12
84 0.1
85 0.11
86 0.14
87 0.16
88 0.15
89 0.14
90 0.21
91 0.24
92 0.3
93 0.31
94 0.35
95 0.38
96 0.42
97 0.46
98 0.47
99 0.49
100 0.46
101 0.45
102 0.42
103 0.39
104 0.38
105 0.34
106 0.25
107 0.24
108 0.23
109 0.21
110 0.24
111 0.25
112 0.31
113 0.42
114 0.46
115 0.48
116 0.56
117 0.64
118 0.69
119 0.76
120 0.78
121 0.79
122 0.84
123 0.85
124 0.87
125 0.85
126 0.78
127 0.76
128 0.75
129 0.74
130 0.68
131 0.67
132 0.63
133 0.6
134 0.6
135 0.56
136 0.51
137 0.45