Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0H2R4W7

Protein Details
Accession A0A0H2R4W7    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
303-324QEYEIKHRKLLRRNVQNIKLCRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, cyto 6, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR015943  WD40/YVTN_repeat-like_dom_sf  
IPR036322  WD40_repeat_dom_sf  
Amino Acid Sequences MSTIELESQSRDRNHIYKPDFREYVHYLRNMQQHENETLSFESRFNRLDPIVHMRCSPDGRWLAVCHFSTCRVYDLELKTCLYFIPGNNYDTLAEHVEWALNGPIILTRSKKELKLWRIPESSVDYPKYGEFLKYERRYIFQRTEVSDNCKYIKWLNERDFLLLRNDGAIHQVDFMAGTNNIIKFNRELMRIYQISQVYPIAANSIDKMLCLATKKMPAYDGSIVSADHVAESDGVDYLFYVEKSIGVDTDITSRDNPMVPCPRWTRGTFKNLHSALSFKQLYHTVFRSRRKLAVDAIGYPVQEYEIKHRKLLRRNVQNIKLCRDHKFMIINYAENELGTTAPELWSLEIDNFDRDKSGTASPFGTVKELPLPNYSFEITNQRWGEASFAGQYHDIIVCEVFDSFSLTEPKVHRHWKSQTWR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.52
3 0.55
4 0.57
5 0.62
6 0.67
7 0.63
8 0.59
9 0.6
10 0.56
11 0.58
12 0.56
13 0.51
14 0.46
15 0.5
16 0.56
17 0.53
18 0.51
19 0.48
20 0.46
21 0.47
22 0.46
23 0.39
24 0.35
25 0.32
26 0.29
27 0.24
28 0.21
29 0.2
30 0.21
31 0.23
32 0.21
33 0.24
34 0.23
35 0.24
36 0.28
37 0.35
38 0.36
39 0.36
40 0.36
41 0.34
42 0.37
43 0.39
44 0.34
45 0.33
46 0.31
47 0.32
48 0.34
49 0.33
50 0.32
51 0.35
52 0.35
53 0.29
54 0.28
55 0.29
56 0.29
57 0.28
58 0.27
59 0.21
60 0.23
61 0.28
62 0.31
63 0.33
64 0.32
65 0.32
66 0.3
67 0.29
68 0.26
69 0.21
70 0.19
71 0.15
72 0.22
73 0.24
74 0.25
75 0.25
76 0.26
77 0.24
78 0.22
79 0.23
80 0.16
81 0.14
82 0.13
83 0.13
84 0.12
85 0.11
86 0.11
87 0.1
88 0.07
89 0.06
90 0.06
91 0.07
92 0.08
93 0.11
94 0.12
95 0.13
96 0.2
97 0.24
98 0.27
99 0.33
100 0.42
101 0.48
102 0.56
103 0.6
104 0.62
105 0.6
106 0.58
107 0.54
108 0.52
109 0.48
110 0.43
111 0.39
112 0.31
113 0.3
114 0.29
115 0.27
116 0.2
117 0.17
118 0.14
119 0.17
120 0.27
121 0.29
122 0.34
123 0.33
124 0.35
125 0.38
126 0.43
127 0.43
128 0.39
129 0.4
130 0.39
131 0.44
132 0.44
133 0.47
134 0.43
135 0.4
136 0.35
137 0.31
138 0.29
139 0.26
140 0.32
141 0.32
142 0.38
143 0.41
144 0.45
145 0.45
146 0.46
147 0.44
148 0.38
149 0.32
150 0.24
151 0.19
152 0.14
153 0.13
154 0.11
155 0.11
156 0.11
157 0.08
158 0.08
159 0.08
160 0.07
161 0.07
162 0.07
163 0.06
164 0.05
165 0.06
166 0.08
167 0.08
168 0.1
169 0.1
170 0.11
171 0.1
172 0.16
173 0.18
174 0.18
175 0.18
176 0.19
177 0.25
178 0.25
179 0.25
180 0.25
181 0.22
182 0.21
183 0.21
184 0.19
185 0.13
186 0.12
187 0.1
188 0.06
189 0.06
190 0.06
191 0.06
192 0.07
193 0.06
194 0.06
195 0.06
196 0.06
197 0.07
198 0.08
199 0.09
200 0.1
201 0.15
202 0.15
203 0.15
204 0.16
205 0.16
206 0.19
207 0.2
208 0.18
209 0.14
210 0.14
211 0.14
212 0.13
213 0.12
214 0.08
215 0.05
216 0.05
217 0.04
218 0.04
219 0.04
220 0.04
221 0.04
222 0.04
223 0.04
224 0.04
225 0.04
226 0.05
227 0.05
228 0.05
229 0.05
230 0.05
231 0.06
232 0.06
233 0.05
234 0.05
235 0.06
236 0.06
237 0.09
238 0.1
239 0.1
240 0.1
241 0.11
242 0.11
243 0.14
244 0.14
245 0.18
246 0.25
247 0.25
248 0.31
249 0.34
250 0.37
251 0.39
252 0.41
253 0.41
254 0.41
255 0.49
256 0.49
257 0.47
258 0.53
259 0.49
260 0.48
261 0.41
262 0.36
263 0.28
264 0.31
265 0.28
266 0.19
267 0.21
268 0.23
269 0.25
270 0.27
271 0.29
272 0.3
273 0.37
274 0.45
275 0.49
276 0.49
277 0.52
278 0.51
279 0.5
280 0.45
281 0.44
282 0.39
283 0.33
284 0.34
285 0.3
286 0.27
287 0.23
288 0.2
289 0.14
290 0.14
291 0.13
292 0.19
293 0.27
294 0.29
295 0.33
296 0.4
297 0.46
298 0.54
299 0.64
300 0.65
301 0.66
302 0.74
303 0.81
304 0.83
305 0.83
306 0.79
307 0.75
308 0.73
309 0.65
310 0.61
311 0.57
312 0.5
313 0.46
314 0.48
315 0.42
316 0.42
317 0.4
318 0.36
319 0.32
320 0.32
321 0.27
322 0.2
323 0.2
324 0.12
325 0.1
326 0.09
327 0.08
328 0.06
329 0.07
330 0.07
331 0.08
332 0.08
333 0.08
334 0.09
335 0.09
336 0.11
337 0.12
338 0.15
339 0.15
340 0.15
341 0.16
342 0.15
343 0.17
344 0.17
345 0.21
346 0.2
347 0.21
348 0.22
349 0.22
350 0.24
351 0.23
352 0.22
353 0.17
354 0.17
355 0.23
356 0.24
357 0.25
358 0.28
359 0.29
360 0.28
361 0.31
362 0.31
363 0.23
364 0.24
365 0.31
366 0.28
367 0.35
368 0.34
369 0.31
370 0.31
371 0.3
372 0.3
373 0.22
374 0.22
375 0.16
376 0.16
377 0.17
378 0.17
379 0.16
380 0.16
381 0.16
382 0.14
383 0.12
384 0.12
385 0.1
386 0.1
387 0.1
388 0.08
389 0.07
390 0.1
391 0.1
392 0.14
393 0.17
394 0.17
395 0.24
396 0.26
397 0.32
398 0.38
399 0.47
400 0.49
401 0.55
402 0.63