Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0H2RA39

Protein Details
Accession A0A0H2RA39   
Localization Confidence Medium
Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
135-159RTRVYRRSGAAKRNRRRRGNETVDDBasic
NLS Segment(s)
PositionSequence
140-152RRSGAAKRNRRRR
Subcellular Location(s) nucl 18, cyto_nucl 13.5, cyto 7
Family & Domain DBs
Amino Acid Sequences MASTSPSLHFGSTFHDNSLPSTKILDEHRAACKYHARRGIEMGERIDGEEVDEETRCLEGRAAILKAQETSSVEIDDEAVHLSSELSSAFWGLETQTRRFTTHLDDVAVANNTPSRPNPKKICEYLNARSFCLSRTRVYRRSGAAKRNRRRRGNETVDDICHLAMERSLHLILSFDVLAPAEILETGLRETCPADSDEEALVLVAPASTPAQSLGGNSGSEN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.25
3 0.25
4 0.28
5 0.33
6 0.29
7 0.22
8 0.23
9 0.21
10 0.23
11 0.27
12 0.3
13 0.28
14 0.31
15 0.38
16 0.39
17 0.4
18 0.39
19 0.45
20 0.43
21 0.48
22 0.5
23 0.47
24 0.46
25 0.5
26 0.53
27 0.5
28 0.48
29 0.41
30 0.35
31 0.31
32 0.3
33 0.25
34 0.18
35 0.13
36 0.11
37 0.1
38 0.09
39 0.09
40 0.08
41 0.08
42 0.09
43 0.08
44 0.07
45 0.07
46 0.07
47 0.09
48 0.12
49 0.13
50 0.14
51 0.14
52 0.15
53 0.15
54 0.14
55 0.14
56 0.12
57 0.13
58 0.13
59 0.12
60 0.12
61 0.11
62 0.11
63 0.09
64 0.08
65 0.06
66 0.05
67 0.05
68 0.05
69 0.05
70 0.04
71 0.04
72 0.04
73 0.04
74 0.04
75 0.04
76 0.04
77 0.04
78 0.04
79 0.04
80 0.09
81 0.12
82 0.13
83 0.18
84 0.2
85 0.21
86 0.21
87 0.22
88 0.23
89 0.25
90 0.25
91 0.21
92 0.2
93 0.19
94 0.2
95 0.18
96 0.13
97 0.08
98 0.08
99 0.08
100 0.08
101 0.09
102 0.17
103 0.21
104 0.29
105 0.35
106 0.39
107 0.45
108 0.48
109 0.51
110 0.48
111 0.51
112 0.5
113 0.52
114 0.48
115 0.41
116 0.39
117 0.36
118 0.3
119 0.3
120 0.25
121 0.21
122 0.28
123 0.36
124 0.41
125 0.44
126 0.47
127 0.45
128 0.53
129 0.56
130 0.58
131 0.6
132 0.65
133 0.72
134 0.78
135 0.84
136 0.82
137 0.84
138 0.82
139 0.82
140 0.81
141 0.76
142 0.73
143 0.66
144 0.58
145 0.51
146 0.43
147 0.32
148 0.23
149 0.17
150 0.1
151 0.09
152 0.09
153 0.08
154 0.1
155 0.1
156 0.1
157 0.1
158 0.1
159 0.09
160 0.1
161 0.09
162 0.07
163 0.07
164 0.07
165 0.07
166 0.06
167 0.06
168 0.04
169 0.04
170 0.05
171 0.04
172 0.05
173 0.06
174 0.07
175 0.07
176 0.07
177 0.09
178 0.09
179 0.1
180 0.11
181 0.13
182 0.13
183 0.15
184 0.15
185 0.14
186 0.13
187 0.11
188 0.1
189 0.07
190 0.06
191 0.04
192 0.04
193 0.05
194 0.06
195 0.06
196 0.06
197 0.07
198 0.09
199 0.09
200 0.11
201 0.13
202 0.14