Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0H2S8Q4

Protein Details
Accession A0A0H2S8Q4    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
57-86MELIRNSKDKRARKLTKKRLGTMRRMKVKMHydrophilic
NLS Segment(s)
PositionSequence
63-83SKDKRARKLTKKRLGTMRRMK
Subcellular Location(s) mito 12, nucl 10, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038097  L36e_sf  
IPR000509  Ribosomal_L36e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01158  Ribosomal_L36e  
PROSITE View protein in PROSITE  
PS01190  RIBOSOMAL_L36E  
Amino Acid Sequences MARSDLIRGLNKGHPTTAIPQTVKPSQRKGIQSNKTKFVRSVIREVAGFAPYEKRVMELIRNSKDKRARKLTKKRLGTMRRMKVKMEELSGVIAEMRRTGAH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.29
3 0.33
4 0.34
5 0.36
6 0.32
7 0.32
8 0.37
9 0.42
10 0.47
11 0.46
12 0.46
13 0.46
14 0.52
15 0.57
16 0.59
17 0.62
18 0.64
19 0.7
20 0.69
21 0.71
22 0.67
23 0.62
24 0.54
25 0.5
26 0.49
27 0.42
28 0.42
29 0.36
30 0.34
31 0.32
32 0.32
33 0.28
34 0.2
35 0.16
36 0.1
37 0.11
38 0.09
39 0.1
40 0.09
41 0.09
42 0.1
43 0.11
44 0.14
45 0.19
46 0.26
47 0.31
48 0.37
49 0.37
50 0.43
51 0.51
52 0.54
53 0.57
54 0.6
55 0.65
56 0.7
57 0.8
58 0.85
59 0.86
60 0.86
61 0.85
62 0.85
63 0.82
64 0.82
65 0.82
66 0.8
67 0.8
68 0.75
69 0.69
70 0.65
71 0.64
72 0.57
73 0.5
74 0.42
75 0.33
76 0.33
77 0.3
78 0.24
79 0.18
80 0.15
81 0.11
82 0.1