Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0H2RZ74

Protein Details
Accession A0A0H2RZ74    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
6-25TTPRRKLFSRTPFRIQHRPSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, mito_nucl 11.333, nucl 8.5, cyto_nucl 7.166, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MKLLRTTPRRKLFSRTPFRIQHRPSGSFVQSSTQPRNFDVVLDNETLYITKELAIALGWHPGSQVEGVPLSLHGWVPTYFTITRKGTDSEWLSRGTVESSVNPNVLQILKKLN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.74
3 0.73
4 0.75
5 0.79
6 0.81
7 0.74
8 0.73
9 0.69
10 0.65
11 0.6
12 0.58
13 0.52
14 0.43
15 0.4
16 0.33
17 0.31
18 0.33
19 0.36
20 0.34
21 0.34
22 0.33
23 0.35
24 0.32
25 0.27
26 0.24
27 0.2
28 0.17
29 0.17
30 0.16
31 0.13
32 0.13
33 0.12
34 0.1
35 0.08
36 0.06
37 0.05
38 0.06
39 0.05
40 0.05
41 0.05
42 0.05
43 0.05
44 0.07
45 0.07
46 0.06
47 0.06
48 0.06
49 0.07
50 0.06
51 0.06
52 0.05
53 0.05
54 0.05
55 0.05
56 0.06
57 0.06
58 0.06
59 0.06
60 0.05
61 0.07
62 0.07
63 0.09
64 0.09
65 0.12
66 0.13
67 0.14
68 0.21
69 0.21
70 0.22
71 0.23
72 0.25
73 0.22
74 0.28
75 0.32
76 0.3
77 0.31
78 0.31
79 0.28
80 0.27
81 0.26
82 0.2
83 0.18
84 0.15
85 0.16
86 0.19
87 0.21
88 0.22
89 0.21
90 0.19
91 0.2
92 0.21
93 0.19