Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0H2RY81

Protein Details
Accession A0A0H2RY81    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
3-46ATIPIVKKRTKAFKRHQSDRYHSVKESWRKPKGIDNRVRRRFKGHydrophilic
NLS Segment(s)
PositionSequence
9-49KKRTKAFKRHQSDRYHSVKESWRKPKGIDNRVRRRFKGQIA
Subcellular Location(s) mito 16.5, mito_nucl 12.833, nucl 8, cyto_nucl 5.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVATIPIVKKRTKAFKRHQSDRYHSVKESWRKPKGIDNRVRRRFKGQIAMPKIGYGSNKKTRHLLPNGLKKLVINNVKEVELLLMHNKSFAAEIAHNVSSRNRILILERARALSVKVTNPAARLRSEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.75
3 0.83
4 0.87
5 0.87
6 0.86
7 0.84
8 0.83
9 0.79
10 0.73
11 0.64
12 0.6
13 0.61
14 0.6
15 0.62
16 0.64
17 0.62
18 0.6
19 0.61
20 0.65
21 0.66
22 0.67
23 0.67
24 0.68
25 0.72
26 0.8
27 0.84
28 0.77
29 0.74
30 0.7
31 0.66
32 0.64
33 0.59
34 0.59
35 0.58
36 0.58
37 0.51
38 0.44
39 0.39
40 0.31
41 0.27
42 0.22
43 0.24
44 0.31
45 0.33
46 0.34
47 0.38
48 0.4
49 0.45
50 0.45
51 0.47
52 0.45
53 0.53
54 0.55
55 0.51
56 0.47
57 0.39
58 0.38
59 0.36
60 0.33
61 0.24
62 0.25
63 0.25
64 0.26
65 0.25
66 0.23
67 0.16
68 0.1
69 0.1
70 0.1
71 0.09
72 0.09
73 0.1
74 0.09
75 0.09
76 0.09
77 0.09
78 0.09
79 0.09
80 0.11
81 0.15
82 0.16
83 0.16
84 0.17
85 0.18
86 0.19
87 0.19
88 0.18
89 0.15
90 0.15
91 0.18
92 0.25
93 0.29
94 0.3
95 0.31
96 0.31
97 0.31
98 0.3
99 0.28
100 0.26
101 0.25
102 0.23
103 0.26
104 0.29
105 0.3
106 0.33
107 0.37
108 0.34