Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0H2RRU6

Protein Details
Accession A0A0H2RRU6    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
98-124AHEKSQKTIRQHKKDIHFPKRKYAVKABasic
NLS Segment(s)
PositionSequence
85-123RVKKTRAIRRRLTAHEKSQKTIRQHKKDIHFPKRKYAVK
Subcellular Location(s) nucl 20.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR018254  Ribosomal_L29_CS  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
PROSITE View protein in PROSITE  
PS00579  RIBOSOMAL_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MLGKVKAYEIKDKSKNELSKQLSELRQELLTLRVQKVAGGSASKLTKINTVRKSIARVLTITNQKQREAVRSLYSGKKYQPLDIRVKKTRAIRRRLTAHEKSQKTIRQHKKDIHFPKRKYAVKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.65
3 0.61
4 0.65
5 0.61
6 0.58
7 0.59
8 0.6
9 0.54
10 0.5
11 0.46
12 0.38
13 0.33
14 0.28
15 0.25
16 0.2
17 0.21
18 0.21
19 0.21
20 0.21
21 0.2
22 0.2
23 0.2
24 0.18
25 0.15
26 0.12
27 0.11
28 0.13
29 0.14
30 0.14
31 0.15
32 0.14
33 0.19
34 0.23
35 0.32
36 0.32
37 0.36
38 0.39
39 0.39
40 0.43
41 0.41
42 0.39
43 0.31
44 0.27
45 0.25
46 0.28
47 0.32
48 0.31
49 0.33
50 0.31
51 0.31
52 0.33
53 0.32
54 0.31
55 0.28
56 0.26
57 0.23
58 0.24
59 0.28
60 0.29
61 0.31
62 0.29
63 0.28
64 0.32
65 0.3
66 0.34
67 0.37
68 0.38
69 0.46
70 0.51
71 0.58
72 0.59
73 0.6
74 0.6
75 0.62
76 0.66
77 0.64
78 0.65
79 0.65
80 0.67
81 0.73
82 0.76
83 0.77
84 0.74
85 0.76
86 0.77
87 0.71
88 0.67
89 0.67
90 0.65
91 0.65
92 0.68
93 0.68
94 0.68
95 0.74
96 0.79
97 0.8
98 0.84
99 0.86
100 0.86
101 0.86
102 0.79
103 0.81
104 0.83