Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0H2RPK3

Protein Details
Accession A0A0H2RPK3    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MMSKKKTRRTNAPRGAPKSPGHydrophilic
NLS Segment(s)
PositionSequence
6-9KTRR
Subcellular Location(s) plas 18, E.R. 4, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR029164  PIG-Y  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF15159  PIG-Y  
Amino Acid Sequences MMSKKKTRRTNAPRGAPKSPGFELDTGLLIVFSVLVFIIGGYAVLFSAFLPLTGIPILDTIATDTHYKYFVFLIIPMGTYFIIANWVGWQYYQNS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.8
3 0.75
4 0.68
5 0.62
6 0.53
7 0.46
8 0.38
9 0.32
10 0.29
11 0.24
12 0.21
13 0.15
14 0.13
15 0.1
16 0.07
17 0.06
18 0.04
19 0.03
20 0.02
21 0.02
22 0.02
23 0.02
24 0.02
25 0.02
26 0.02
27 0.02
28 0.02
29 0.02
30 0.02
31 0.02
32 0.02
33 0.02
34 0.04
35 0.03
36 0.03
37 0.04
38 0.04
39 0.05
40 0.05
41 0.05
42 0.04
43 0.04
44 0.05
45 0.04
46 0.04
47 0.04
48 0.05
49 0.06
50 0.07
51 0.08
52 0.09
53 0.1
54 0.1
55 0.1
56 0.1
57 0.1
58 0.1
59 0.1
60 0.12
61 0.11
62 0.12
63 0.11
64 0.12
65 0.1
66 0.1
67 0.1
68 0.06
69 0.09
70 0.08
71 0.08
72 0.09
73 0.1
74 0.1
75 0.1