Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0H2R672

Protein Details
Accession A0A0H2R672   
Localization Confidence Low
Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
20-42LPPYTFPPLSRRRRRHSDDGIYRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 12, mito 6, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MPDVVSIPAVPCIPPSTSLLPPYTFPPLSRRRRRHSDDGIYRELLTRPLKVFGLRSIASYRSNSNVDGIDRKLLRGAVVSSDTHRRARNDGIYRKRSMSCVDRARM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.18
3 0.21
4 0.23
5 0.26
6 0.28
7 0.26
8 0.26
9 0.27
10 0.29
11 0.25
12 0.23
13 0.29
14 0.37
15 0.47
16 0.56
17 0.62
18 0.65
19 0.74
20 0.81
21 0.82
22 0.82
23 0.82
24 0.8
25 0.77
26 0.71
27 0.62
28 0.54
29 0.46
30 0.36
31 0.31
32 0.23
33 0.19
34 0.16
35 0.17
36 0.18
37 0.17
38 0.17
39 0.14
40 0.17
41 0.15
42 0.16
43 0.16
44 0.17
45 0.18
46 0.19
47 0.18
48 0.17
49 0.18
50 0.17
51 0.17
52 0.16
53 0.16
54 0.17
55 0.17
56 0.19
57 0.18
58 0.18
59 0.18
60 0.17
61 0.15
62 0.14
63 0.14
64 0.11
65 0.13
66 0.14
67 0.15
68 0.22
69 0.25
70 0.29
71 0.32
72 0.32
73 0.35
74 0.41
75 0.48
76 0.51
77 0.58
78 0.64
79 0.66
80 0.67
81 0.67
82 0.62
83 0.56
84 0.53
85 0.5
86 0.49