Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0H2S449

Protein Details
Accession A0A0H2S449    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MVTSRRCRGRCSRCCRRRETRRVCLLSTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, plas 3, E.R. 3, cyto 2
Family & Domain DBs
Amino Acid Sequences MVTSRRCRGRCSRCCRRRETRRVCLLSTIITTLSLCSLLRPPDGRTRPIRCLQVMAISVLEVVRLGKRTPMDAFDGNEIEGEVIRNGLAH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.87
3 0.87
4 0.87
5 0.88
6 0.88
7 0.87
8 0.88
9 0.84
10 0.76
11 0.68
12 0.58
13 0.49
14 0.39
15 0.29
16 0.18
17 0.14
18 0.13
19 0.1
20 0.09
21 0.07
22 0.06
23 0.06
24 0.09
25 0.1
26 0.11
27 0.13
28 0.15
29 0.24
30 0.27
31 0.31
32 0.35
33 0.39
34 0.43
35 0.46
36 0.47
37 0.38
38 0.37
39 0.33
40 0.3
41 0.26
42 0.21
43 0.16
44 0.12
45 0.12
46 0.09
47 0.08
48 0.04
49 0.05
50 0.06
51 0.07
52 0.08
53 0.11
54 0.12
55 0.15
56 0.17
57 0.19
58 0.23
59 0.24
60 0.25
61 0.25
62 0.25
63 0.22
64 0.21
65 0.18
66 0.13
67 0.11
68 0.11
69 0.07
70 0.07