Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0H2QZS1

Protein Details
Accession A0A0H2QZS1   
Localization Confidence Low
Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
103-124MLRKPTRNSRVQQKRPRSRTLTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, mito_nucl 12, mito 9.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR000554  Ribosomal_S7e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01251  Ribosomal_S7e  
Amino Acid Sequences MASVNHKILRTANAPTTSPDETETMVAQALIEVESNVPDLKNEIRPLQISAARQVDVRGGKKAVVVFVPVPQLKAFRKILPRLVRELEKKFDSHFVFVAQRRMLRKPTRNSRVQQKRPRSRTLTDVHEKILEDLVFPTEIVGKRTRVKEDGSKLLKVHLDPKDKTSLEYKLDSFSSVYRRLTGKEVIFEFPAAPVE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.36
3 0.38
4 0.34
5 0.32
6 0.28
7 0.23
8 0.21
9 0.22
10 0.19
11 0.14
12 0.13
13 0.11
14 0.09
15 0.08
16 0.07
17 0.06
18 0.05
19 0.05
20 0.05
21 0.06
22 0.07
23 0.07
24 0.07
25 0.06
26 0.09
27 0.12
28 0.17
29 0.19
30 0.2
31 0.22
32 0.23
33 0.25
34 0.28
35 0.28
36 0.24
37 0.27
38 0.27
39 0.25
40 0.24
41 0.23
42 0.23
43 0.25
44 0.25
45 0.23
46 0.21
47 0.21
48 0.23
49 0.23
50 0.19
51 0.14
52 0.15
53 0.12
54 0.13
55 0.18
56 0.16
57 0.16
58 0.15
59 0.19
60 0.18
61 0.24
62 0.24
63 0.24
64 0.31
65 0.33
66 0.41
67 0.45
68 0.46
69 0.44
70 0.45
71 0.46
72 0.45
73 0.45
74 0.41
75 0.35
76 0.33
77 0.3
78 0.33
79 0.28
80 0.24
81 0.21
82 0.18
83 0.21
84 0.22
85 0.25
86 0.2
87 0.22
88 0.23
89 0.26
90 0.31
91 0.35
92 0.42
93 0.47
94 0.57
95 0.62
96 0.66
97 0.68
98 0.72
99 0.75
100 0.77
101 0.78
102 0.78
103 0.81
104 0.8
105 0.84
106 0.79
107 0.7
108 0.67
109 0.62
110 0.6
111 0.56
112 0.51
113 0.44
114 0.4
115 0.37
116 0.3
117 0.28
118 0.19
119 0.13
120 0.12
121 0.11
122 0.1
123 0.09
124 0.09
125 0.1
126 0.11
127 0.14
128 0.16
129 0.19
130 0.25
131 0.29
132 0.33
133 0.31
134 0.35
135 0.41
136 0.44
137 0.51
138 0.49
139 0.48
140 0.44
141 0.46
142 0.43
143 0.36
144 0.38
145 0.36
146 0.41
147 0.39
148 0.43
149 0.48
150 0.45
151 0.46
152 0.43
153 0.41
154 0.37
155 0.39
156 0.36
157 0.31
158 0.31
159 0.3
160 0.26
161 0.24
162 0.26
163 0.27
164 0.27
165 0.28
166 0.29
167 0.31
168 0.34
169 0.37
170 0.34
171 0.36
172 0.37
173 0.36
174 0.35
175 0.33
176 0.29