Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0H2RPG9

Protein Details
Accession A0A0H2RPG9    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
4-28SSSRGFPASRSRRRNLPRRRRGLFAHydrophilic
NLS Segment(s)
PositionSequence
12-24SRSRRRNLPRRRR
Subcellular Location(s) mito 14, nucl 10, cyto_nucl 7
Family & Domain DBs
Amino Acid Sequences MRHSSSRGFPASRSRRRNLPRRRRGLFAGSLLSSPSVFGDQSSKSGCALGVNIYVRQVKHFECKTLTSSKEIVNFGRPVYQAQRC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.65
3 0.73
4 0.8
5 0.8
6 0.81
7 0.82
8 0.84
9 0.83
10 0.78
11 0.73
12 0.69
13 0.61
14 0.53
15 0.45
16 0.35
17 0.31
18 0.26
19 0.21
20 0.15
21 0.11
22 0.08
23 0.06
24 0.05
25 0.05
26 0.08
27 0.08
28 0.1
29 0.11
30 0.11
31 0.1
32 0.11
33 0.1
34 0.08
35 0.08
36 0.07
37 0.09
38 0.1
39 0.1
40 0.12
41 0.14
42 0.14
43 0.15
44 0.17
45 0.16
46 0.24
47 0.26
48 0.27
49 0.28
50 0.31
51 0.33
52 0.37
53 0.37
54 0.32
55 0.33
56 0.33
57 0.36
58 0.36
59 0.34
60 0.33
61 0.33
62 0.29
63 0.31
64 0.29
65 0.28