Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0H2R6B7

Protein Details
Accession A0A0H2R6B7    Localization Confidence Low Confidence Score 6.6
NoLS Segment(s)
PositionSequenceProtein Nature
429-449STAAGADRKKVRRNIMRRSQFHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 18.5, cyto_nucl 14.333, cyto_mito 10.166, nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR045116  Clp1/Grc3  
IPR032319  CLP1_P  
IPR027417  P-loop_NTPase  
Gene Ontology GO:0005524  F:ATP binding  
GO:0051731  F:polynucleotide 5'-hydroxyl-kinase activity  
GO:0006396  P:RNA processing  
Pfam View protein in Pfam  
PF16575  CLP1_P  
Amino Acid Sequences MTCICPPAWRTAIEDLVLQGSLSTEGGRRDCRPFLLSGAKNVGKSSFARVLLNRLLSNHPRVAYLECDPGQPEFTSSGLLSLHLVDEPVYGPPFSHLRTPYRSHFLGSTSPRNNPSYYISCIESLIETYTQNFRSLDYDVYDSDREVVPLVVNTMGWTKGLGGDLLKKIEELVMPSHIITIGEVSELRSSDNSQPATTATSRSQIASRAFESPEPQRINVESIPYNPESARYTSADWRALSLMSYFHSSYHTSFSDIESLLQWNTNSPLLSNKPYAVSPRAALDSVILTGSGSDDVVPSEIGRVLNGAIVAFVTCEPGSVDASSTPRSAAIPYVQGAPLPDPRTSNCLGLGLIRGVSPSLLSPEGRLDEQTRTEILHIITPVPLSVLRDESCRCIVKGEIELPVWGMTDSRENLGGSAIDIPYLQSRRSTAAGADRKKVRRNIMRRSQF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.25
3 0.23
4 0.22
5 0.17
6 0.11
7 0.09
8 0.09
9 0.08
10 0.08
11 0.1
12 0.14
13 0.19
14 0.24
15 0.27
16 0.32
17 0.35
18 0.38
19 0.38
20 0.35
21 0.37
22 0.43
23 0.4
24 0.4
25 0.46
26 0.45
27 0.43
28 0.42
29 0.37
30 0.3
31 0.29
32 0.31
33 0.29
34 0.28
35 0.31
36 0.32
37 0.37
38 0.39
39 0.41
40 0.35
41 0.32
42 0.37
43 0.38
44 0.43
45 0.4
46 0.36
47 0.34
48 0.34
49 0.34
50 0.31
51 0.29
52 0.3
53 0.26
54 0.27
55 0.27
56 0.26
57 0.25
58 0.21
59 0.2
60 0.14
61 0.14
62 0.15
63 0.13
64 0.14
65 0.11
66 0.11
67 0.1
68 0.09
69 0.09
70 0.08
71 0.08
72 0.07
73 0.07
74 0.07
75 0.09
76 0.09
77 0.09
78 0.09
79 0.11
80 0.14
81 0.15
82 0.2
83 0.23
84 0.28
85 0.34
86 0.4
87 0.43
88 0.47
89 0.46
90 0.42
91 0.39
92 0.36
93 0.37
94 0.38
95 0.42
96 0.39
97 0.43
98 0.45
99 0.46
100 0.44
101 0.38
102 0.39
103 0.33
104 0.34
105 0.32
106 0.29
107 0.27
108 0.27
109 0.24
110 0.18
111 0.15
112 0.12
113 0.1
114 0.09
115 0.11
116 0.15
117 0.15
118 0.17
119 0.16
120 0.16
121 0.17
122 0.18
123 0.18
124 0.15
125 0.16
126 0.15
127 0.17
128 0.17
129 0.15
130 0.15
131 0.13
132 0.12
133 0.11
134 0.1
135 0.08
136 0.07
137 0.08
138 0.07
139 0.06
140 0.07
141 0.07
142 0.07
143 0.07
144 0.07
145 0.06
146 0.07
147 0.07
148 0.07
149 0.07
150 0.11
151 0.13
152 0.14
153 0.13
154 0.12
155 0.12
156 0.12
157 0.12
158 0.09
159 0.09
160 0.1
161 0.1
162 0.1
163 0.1
164 0.09
165 0.09
166 0.07
167 0.06
168 0.04
169 0.05
170 0.05
171 0.05
172 0.06
173 0.06
174 0.07
175 0.07
176 0.1
177 0.13
178 0.18
179 0.18
180 0.17
181 0.17
182 0.17
183 0.2
184 0.18
185 0.17
186 0.13
187 0.15
188 0.15
189 0.16
190 0.16
191 0.17
192 0.19
193 0.19
194 0.19
195 0.19
196 0.19
197 0.19
198 0.21
199 0.19
200 0.25
201 0.23
202 0.22
203 0.21
204 0.21
205 0.24
206 0.22
207 0.22
208 0.15
209 0.15
210 0.18
211 0.17
212 0.17
213 0.13
214 0.15
215 0.14
216 0.15
217 0.16
218 0.14
219 0.16
220 0.19
221 0.23
222 0.24
223 0.21
224 0.21
225 0.19
226 0.17
227 0.16
228 0.12
229 0.09
230 0.07
231 0.09
232 0.09
233 0.09
234 0.11
235 0.12
236 0.12
237 0.15
238 0.15
239 0.14
240 0.15
241 0.15
242 0.16
243 0.14
244 0.14
245 0.11
246 0.12
247 0.1
248 0.11
249 0.1
250 0.08
251 0.09
252 0.1
253 0.09
254 0.09
255 0.13
256 0.15
257 0.19
258 0.19
259 0.19
260 0.19
261 0.2
262 0.23
263 0.21
264 0.19
265 0.17
266 0.18
267 0.18
268 0.17
269 0.16
270 0.13
271 0.1
272 0.09
273 0.09
274 0.06
275 0.05
276 0.05
277 0.05
278 0.04
279 0.04
280 0.04
281 0.04
282 0.04
283 0.05
284 0.05
285 0.04
286 0.05
287 0.07
288 0.07
289 0.07
290 0.07
291 0.07
292 0.07
293 0.07
294 0.06
295 0.04
296 0.04
297 0.04
298 0.05
299 0.04
300 0.06
301 0.05
302 0.06
303 0.06
304 0.07
305 0.09
306 0.08
307 0.09
308 0.09
309 0.12
310 0.14
311 0.14
312 0.13
313 0.12
314 0.13
315 0.13
316 0.13
317 0.13
318 0.13
319 0.14
320 0.16
321 0.15
322 0.15
323 0.15
324 0.16
325 0.2
326 0.2
327 0.2
328 0.2
329 0.22
330 0.27
331 0.28
332 0.26
333 0.21
334 0.2
335 0.18
336 0.17
337 0.17
338 0.13
339 0.11
340 0.1
341 0.1
342 0.09
343 0.08
344 0.07
345 0.06
346 0.08
347 0.1
348 0.1
349 0.11
350 0.14
351 0.17
352 0.17
353 0.19
354 0.18
355 0.2
356 0.22
357 0.24
358 0.21
359 0.2
360 0.2
361 0.21
362 0.19
363 0.19
364 0.17
365 0.16
366 0.16
367 0.15
368 0.14
369 0.12
370 0.12
371 0.11
372 0.12
373 0.15
374 0.16
375 0.2
376 0.22
377 0.25
378 0.3
379 0.3
380 0.28
381 0.27
382 0.28
383 0.28
384 0.32
385 0.31
386 0.28
387 0.26
388 0.26
389 0.25
390 0.23
391 0.19
392 0.14
393 0.11
394 0.09
395 0.14
396 0.15
397 0.16
398 0.18
399 0.17
400 0.18
401 0.19
402 0.17
403 0.12
404 0.14
405 0.12
406 0.11
407 0.1
408 0.12
409 0.17
410 0.2
411 0.2
412 0.19
413 0.21
414 0.25
415 0.27
416 0.27
417 0.24
418 0.33
419 0.41
420 0.44
421 0.51
422 0.56
423 0.62
424 0.69
425 0.73
426 0.73
427 0.74
428 0.79
429 0.82