Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0H2RTS1

Protein Details
Accession A0A0H2RTS1    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
258-283PVTAMYRRKSSRRKDSTRRPTFNDEKHydrophilic
301-321VEKPRGPPKARTKPKETSRNVBasic
NLS Segment(s)
PositionSequence
264-315RRKSSRRKDSTRRPTFNDEKDQGGAKKEKRKSAFWVWVEKPRGPPKARTKPK
Subcellular Location(s) plas 21, cyto 3, mito 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSPPPPPPKDTSPRSKPAGGFVSHPRTRRATTSAAAAVASRVRRLSSSSSLVGKKGKGFSWFRFRRPSLFNCIRVAVFLGVILWTVVCLAIAVHFDGILVASDLTHFVPFAIFASVATLLIILVLLISSPFKQRNPVSTRIELGLLGLLGVLWLALSVFLATSESAEADVECFAADSVSTDPTESPTFSTATYHAQYRVLMAFSIFNAILVWGFLLFLLFLAFREHRKGHVEVWREPVPVYPWFGRGEKATKEGLPAPVTAMYRRKSSRRKDSTRRPTFNDEKDQGGAKKEKRKSAFWVWVEKPRGPPKARTKPKETSRNVTIPTTTAPRRVVRDTVINITRPTVPRASTMPNPARGTTGGASKQTPKVSPPRTTTRSQTQPQLSSTTLPRTQSAPRIQTLPRSQTVPKMSTVKIVTKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.75
3 0.67
4 0.65
5 0.63
6 0.54
7 0.49
8 0.51
9 0.55
10 0.53
11 0.54
12 0.51
13 0.5
14 0.52
15 0.52
16 0.48
17 0.44
18 0.41
19 0.45
20 0.42
21 0.36
22 0.33
23 0.28
24 0.24
25 0.23
26 0.22
27 0.18
28 0.17
29 0.17
30 0.18
31 0.22
32 0.27
33 0.28
34 0.32
35 0.34
36 0.39
37 0.4
38 0.43
39 0.44
40 0.4
41 0.4
42 0.39
43 0.38
44 0.39
45 0.44
46 0.47
47 0.54
48 0.58
49 0.59
50 0.65
51 0.64
52 0.63
53 0.64
54 0.62
55 0.62
56 0.63
57 0.61
58 0.54
59 0.54
60 0.46
61 0.4
62 0.36
63 0.26
64 0.17
65 0.13
66 0.1
67 0.07
68 0.07
69 0.07
70 0.04
71 0.03
72 0.04
73 0.03
74 0.03
75 0.03
76 0.03
77 0.04
78 0.05
79 0.06
80 0.05
81 0.05
82 0.05
83 0.05
84 0.06
85 0.05
86 0.04
87 0.04
88 0.04
89 0.04
90 0.05
91 0.06
92 0.06
93 0.06
94 0.05
95 0.05
96 0.06
97 0.06
98 0.06
99 0.06
100 0.06
101 0.07
102 0.08
103 0.07
104 0.07
105 0.06
106 0.05
107 0.05
108 0.04
109 0.02
110 0.02
111 0.02
112 0.02
113 0.02
114 0.03
115 0.04
116 0.08
117 0.11
118 0.12
119 0.2
120 0.22
121 0.32
122 0.37
123 0.44
124 0.46
125 0.46
126 0.47
127 0.41
128 0.39
129 0.3
130 0.24
131 0.16
132 0.09
133 0.07
134 0.05
135 0.04
136 0.03
137 0.03
138 0.02
139 0.01
140 0.02
141 0.02
142 0.02
143 0.02
144 0.02
145 0.02
146 0.02
147 0.03
148 0.03
149 0.04
150 0.04
151 0.04
152 0.04
153 0.04
154 0.04
155 0.04
156 0.04
157 0.04
158 0.04
159 0.04
160 0.03
161 0.03
162 0.03
163 0.04
164 0.05
165 0.06
166 0.06
167 0.06
168 0.07
169 0.09
170 0.1
171 0.09
172 0.1
173 0.1
174 0.11
175 0.1
176 0.12
177 0.1
178 0.13
179 0.14
180 0.14
181 0.14
182 0.14
183 0.14
184 0.14
185 0.14
186 0.1
187 0.09
188 0.08
189 0.07
190 0.06
191 0.08
192 0.06
193 0.06
194 0.05
195 0.05
196 0.05
197 0.04
198 0.04
199 0.02
200 0.03
201 0.02
202 0.02
203 0.02
204 0.02
205 0.03
206 0.03
207 0.03
208 0.06
209 0.07
210 0.08
211 0.12
212 0.13
213 0.15
214 0.19
215 0.2
216 0.23
217 0.29
218 0.33
219 0.32
220 0.38
221 0.38
222 0.35
223 0.33
224 0.3
225 0.26
226 0.22
227 0.22
228 0.17
229 0.17
230 0.19
231 0.19
232 0.19
233 0.19
234 0.22
235 0.2
236 0.22
237 0.22
238 0.2
239 0.21
240 0.23
241 0.23
242 0.2
243 0.18
244 0.16
245 0.18
246 0.18
247 0.19
248 0.23
249 0.21
250 0.26
251 0.3
252 0.38
253 0.44
254 0.54
255 0.62
256 0.67
257 0.75
258 0.8
259 0.88
260 0.9
261 0.91
262 0.87
263 0.82
264 0.81
265 0.79
266 0.75
267 0.73
268 0.64
269 0.55
270 0.51
271 0.49
272 0.41
273 0.38
274 0.39
275 0.36
276 0.44
277 0.47
278 0.54
279 0.54
280 0.57
281 0.59
282 0.61
283 0.64
284 0.58
285 0.62
286 0.57
287 0.62
288 0.62
289 0.57
290 0.56
291 0.54
292 0.59
293 0.53
294 0.59
295 0.62
296 0.69
297 0.77
298 0.76
299 0.76
300 0.77
301 0.84
302 0.85
303 0.8
304 0.77
305 0.74
306 0.73
307 0.67
308 0.59
309 0.5
310 0.41
311 0.38
312 0.36
313 0.31
314 0.3
315 0.32
316 0.34
317 0.38
318 0.4
319 0.4
320 0.37
321 0.42
322 0.4
323 0.43
324 0.43
325 0.4
326 0.37
327 0.36
328 0.38
329 0.33
330 0.33
331 0.29
332 0.26
333 0.27
334 0.31
335 0.34
336 0.34
337 0.42
338 0.44
339 0.48
340 0.5
341 0.47
342 0.45
343 0.4
344 0.39
345 0.31
346 0.32
347 0.28
348 0.28
349 0.3
350 0.33
351 0.38
352 0.38
353 0.37
354 0.37
355 0.44
356 0.49
357 0.54
358 0.56
359 0.61
360 0.62
361 0.66
362 0.67
363 0.67
364 0.69
365 0.66
366 0.68
367 0.66
368 0.65
369 0.62
370 0.59
371 0.5
372 0.45
373 0.44
374 0.43
375 0.39
376 0.37
377 0.36
378 0.35
379 0.4
380 0.45
381 0.49
382 0.47
383 0.45
384 0.49
385 0.5
386 0.56
387 0.59
388 0.57
389 0.51
390 0.51
391 0.5
392 0.53
393 0.58
394 0.51
395 0.48
396 0.47
397 0.45
398 0.47
399 0.5