Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0H2RJI7

Protein Details
Accession A0A0H2RJI7    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
12-38CYSSKARRGSLTRRRRRPKAMSVHIASHydrophilic
NLS Segment(s)
PositionSequence
17-30ARRGSLTRRRRRPK
Subcellular Location(s) mito 16, nucl 6, plas 3
Family & Domain DBs
Amino Acid Sequences MKRLRHNYWHWCYSSKARRGSLTRRRRRPKAMSVHIASSRCVELFLFAVVLRRQINAYLALTGRIECLRASTSMHCPRQNSGPKIYFDGIFRELANCVVC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.6
3 0.58
4 0.55
5 0.59
6 0.64
7 0.7
8 0.7
9 0.71
10 0.74
11 0.78
12 0.84
13 0.86
14 0.88
15 0.86
16 0.86
17 0.85
18 0.83
19 0.81
20 0.73
21 0.69
22 0.64
23 0.55
24 0.46
25 0.36
26 0.28
27 0.19
28 0.17
29 0.12
30 0.08
31 0.08
32 0.07
33 0.06
34 0.05
35 0.08
36 0.07
37 0.1
38 0.09
39 0.09
40 0.09
41 0.1
42 0.11
43 0.1
44 0.1
45 0.1
46 0.09
47 0.1
48 0.1
49 0.1
50 0.1
51 0.08
52 0.08
53 0.07
54 0.08
55 0.09
56 0.1
57 0.12
58 0.14
59 0.24
60 0.32
61 0.39
62 0.4
63 0.41
64 0.43
65 0.5
66 0.57
67 0.52
68 0.52
69 0.51
70 0.5
71 0.54
72 0.53
73 0.45
74 0.37
75 0.37
76 0.3
77 0.26
78 0.24
79 0.2
80 0.19