Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0H2RER5

Protein Details
Accession A0A0H2RER5    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
66-87PCSSRWPRSPTRKYHTERFPTSHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 12, mito 9, plas 2, E.R. 2
Family & Domain DBs
Amino Acid Sequences MRRRGSIPVLQVFKLLAYLLIHVKLGRQTKGASNEGISVRCDSYSRRVFYSKGSFRYFICCSVHLPCSSRWPRSPTRKYHTERFPTSGVE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.18
3 0.11
4 0.08
5 0.09
6 0.1
7 0.11
8 0.11
9 0.11
10 0.12
11 0.16
12 0.2
13 0.19
14 0.19
15 0.21
16 0.26
17 0.32
18 0.32
19 0.27
20 0.24
21 0.26
22 0.26
23 0.25
24 0.2
25 0.16
26 0.14
27 0.14
28 0.14
29 0.11
30 0.18
31 0.23
32 0.24
33 0.25
34 0.26
35 0.27
36 0.32
37 0.4
38 0.37
39 0.37
40 0.39
41 0.37
42 0.36
43 0.42
44 0.38
45 0.32
46 0.28
47 0.24
48 0.23
49 0.26
50 0.28
51 0.24
52 0.25
53 0.23
54 0.32
55 0.36
56 0.4
57 0.42
58 0.46
59 0.54
60 0.63
61 0.71
62 0.7
63 0.73
64 0.77
65 0.79
66 0.81
67 0.82
68 0.8
69 0.77
70 0.72