Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0H2RQ52

Protein Details
Accession A0A0H2RQ52   
Localization Confidence High
Confidence Score 16
NoLS Segment(s)
PositionSequenceProtein Nature
4-29LANSNSSSSRPRRRRRDSSGNEHIPRHydrophilic
78-101EEMAERKKAEHKKRYPDYRFQPKHBasic
NLS Segment(s)
PositionSequence
15-18RRRR
83-91RKKAEHKKR
Subcellular Location(s) nucl 20.5, mito_nucl 13.666, cyto_nucl 11.833, mito 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01389  HMG-box_ROX1-like  
Amino Acid Sequences MSSLANSNSSSSRPRRRRRDSSGNEHIPRPPNAFMLYRQNFVHQRHVPGSIETNHNSLSRIVGDCWKQLPASEKKVWEEMAERKKAEHKKRYPDYRFQPKH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.7
3 0.79
4 0.86
5 0.88
6 0.9
7 0.89
8 0.88
9 0.88
10 0.87
11 0.8
12 0.71
13 0.67
14 0.6
15 0.53
16 0.47
17 0.38
18 0.3
19 0.3
20 0.29
21 0.27
22 0.33
23 0.32
24 0.3
25 0.29
26 0.32
27 0.35
28 0.36
29 0.43
30 0.34
31 0.36
32 0.34
33 0.36
34 0.32
35 0.27
36 0.27
37 0.2
38 0.21
39 0.19
40 0.18
41 0.18
42 0.17
43 0.17
44 0.14
45 0.13
46 0.11
47 0.11
48 0.11
49 0.14
50 0.15
51 0.16
52 0.17
53 0.17
54 0.15
55 0.16
56 0.23
57 0.25
58 0.31
59 0.34
60 0.36
61 0.38
62 0.4
63 0.39
64 0.33
65 0.32
66 0.34
67 0.39
68 0.41
69 0.39
70 0.39
71 0.48
72 0.56
73 0.61
74 0.63
75 0.63
76 0.69
77 0.79
78 0.88
79 0.87
80 0.88
81 0.88