Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0H2RLY8

Protein Details
Accession A0A0H2RLY8    Localization Confidence High Confidence Score 20.4
NoLS Segment(s)
PositionSequenceProtein Nature
34-54PAVPVKRGRGRPKGSKNKTTAHydrophilic
62-102AGPSGEKRKRGRPPKPKPEGEVDVPKRPRGRPPKNPKPAAABasic
113-132AAEGEPPKKKRGRPPKVAAEBasic
NLS Segment(s)
PositionSequence
38-105VKRGRGRPKGSKNKTTAAKTDTPAAGPSGEKRKRGRPPKPKPEGEVDVPKRPRGRPPKNPKPAAAPKK
116-129GEPPKKKRGRPPKV
Subcellular Location(s) nucl 21.5, cyto_nucl 13.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR017956  AT_hook_DNA-bd_motif  
IPR000116  HMGA  
Gene Ontology GO:0000785  C:chromatin  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0006355  P:regulation of DNA-templated transcription  
Pfam View protein in Pfam  
PF02178  AT_hook  
Amino Acid Sequences MSASPKADEPAVEKVADDQHEEDQVQDTDEPAAPAVPVKRGRGRPKGSKNKTTAAKTDTPAAGPSGEKRKRGRPPKPKPEGEVDVPKRPRGRPPKNPKPAAAPKKDDEEEDEAAEGEPPKKKRGRPPKVAAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.26
3 0.26
4 0.24
5 0.2
6 0.2
7 0.22
8 0.22
9 0.2
10 0.18
11 0.17
12 0.16
13 0.14
14 0.13
15 0.12
16 0.13
17 0.12
18 0.09
19 0.09
20 0.07
21 0.1
22 0.1
23 0.15
24 0.17
25 0.22
26 0.29
27 0.38
28 0.46
29 0.54
30 0.61
31 0.65
32 0.73
33 0.8
34 0.8
35 0.8
36 0.76
37 0.74
38 0.73
39 0.66
40 0.59
41 0.54
42 0.5
43 0.42
44 0.41
45 0.34
46 0.27
47 0.24
48 0.2
49 0.15
50 0.11
51 0.14
52 0.2
53 0.23
54 0.28
55 0.31
56 0.39
57 0.48
58 0.59
59 0.66
60 0.67
61 0.75
62 0.81
63 0.87
64 0.82
65 0.76
66 0.73
67 0.67
68 0.61
69 0.6
70 0.54
71 0.53
72 0.51
73 0.52
74 0.49
75 0.46
76 0.51
77 0.52
78 0.58
79 0.6
80 0.7
81 0.76
82 0.83
83 0.85
84 0.78
85 0.77
86 0.78
87 0.76
88 0.74
89 0.69
90 0.61
91 0.64
92 0.62
93 0.53
94 0.48
95 0.43
96 0.36
97 0.31
98 0.28
99 0.21
100 0.2
101 0.21
102 0.17
103 0.16
104 0.21
105 0.22
106 0.31
107 0.37
108 0.45
109 0.54
110 0.63
111 0.7
112 0.75