Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0H2QZE7

Protein Details
Accession A0A0H2QZE7    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-31GKGKGKSGKEKSKCDNCKKTGHSREQCRAKGBasic
NLS Segment(s)
Subcellular Location(s) nucl 14, mito 12, cyto_nucl 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036875  Znf_CCHC_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Amino Acid Sequences GKGKGKSGKEKSKCDNCKKTGHSREQCRAKGGGREGQGPSSNRFGNGKADESSSKAKTVNLADDNSTLVTVNAASTASTQWIVDSGATAHICS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.87
3 0.81
4 0.82
5 0.8
6 0.81
7 0.8
8 0.81
9 0.79
10 0.79
11 0.83
12 0.83
13 0.78
14 0.7
15 0.63
16 0.55
17 0.52
18 0.47
19 0.42
20 0.34
21 0.36
22 0.34
23 0.33
24 0.34
25 0.29
26 0.27
27 0.26
28 0.24
29 0.21
30 0.21
31 0.2
32 0.21
33 0.21
34 0.2
35 0.17
36 0.19
37 0.18
38 0.2
39 0.24
40 0.19
41 0.19
42 0.18
43 0.17
44 0.19
45 0.21
46 0.23
47 0.22
48 0.22
49 0.22
50 0.22
51 0.22
52 0.18
53 0.17
54 0.11
55 0.08
56 0.07
57 0.06
58 0.05
59 0.05
60 0.05
61 0.05
62 0.06
63 0.06
64 0.08
65 0.08
66 0.08
67 0.08
68 0.09
69 0.09
70 0.08
71 0.09
72 0.08
73 0.12