Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0H2RHM8

Protein Details
Accession A0A0H2RHM8   
Localization Confidence Medium
Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
128-155DDRPMPKGPIFPRRRRRRRAAVVQPAGGBasic
NLS Segment(s)
PositionSequence
134-147KGPIFPRRRRRRRA
Subcellular Location(s) nucl 22.5, cyto_nucl 13, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011993  PH-like_dom_sf  
Amino Acid Sequences MSETTPSASASTISVNSNPSSSHSHSNSLSSHFRSHHRNRDPASTSASPTDSLGGKELLPEPNRKDLIREYSMQNAESGLASDYFKRKNVLRVRLQGEQFLLQAPDVPGVIEWIEGLQAAANIALDLDDRPMPKGPIFPRRRRRRRAAVVQPAGGEETAVPTNAPNP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.17
3 0.17
4 0.18
5 0.17
6 0.18
7 0.23
8 0.25
9 0.31
10 0.32
11 0.36
12 0.36
13 0.39
14 0.37
15 0.36
16 0.37
17 0.32
18 0.34
19 0.32
20 0.36
21 0.43
22 0.51
23 0.56
24 0.59
25 0.63
26 0.62
27 0.68
28 0.67
29 0.6
30 0.58
31 0.49
32 0.43
33 0.37
34 0.35
35 0.26
36 0.22
37 0.21
38 0.15
39 0.13
40 0.13
41 0.11
42 0.1
43 0.11
44 0.13
45 0.17
46 0.18
47 0.22
48 0.23
49 0.29
50 0.31
51 0.3
52 0.3
53 0.29
54 0.34
55 0.32
56 0.32
57 0.27
58 0.31
59 0.32
60 0.3
61 0.25
62 0.19
63 0.16
64 0.13
65 0.12
66 0.06
67 0.06
68 0.06
69 0.08
70 0.1
71 0.11
72 0.12
73 0.14
74 0.15
75 0.23
76 0.31
77 0.38
78 0.42
79 0.48
80 0.51
81 0.55
82 0.54
83 0.46
84 0.4
85 0.32
86 0.25
87 0.19
88 0.15
89 0.09
90 0.1
91 0.08
92 0.08
93 0.07
94 0.06
95 0.06
96 0.06
97 0.06
98 0.05
99 0.04
100 0.04
101 0.04
102 0.04
103 0.04
104 0.03
105 0.03
106 0.03
107 0.03
108 0.03
109 0.03
110 0.03
111 0.03
112 0.03
113 0.04
114 0.06
115 0.08
116 0.08
117 0.11
118 0.13
119 0.15
120 0.15
121 0.23
122 0.28
123 0.37
124 0.46
125 0.55
126 0.64
127 0.73
128 0.83
129 0.86
130 0.9
131 0.9
132 0.91
133 0.92
134 0.92
135 0.92
136 0.87
137 0.8
138 0.7
139 0.59
140 0.5
141 0.38
142 0.27
143 0.16
144 0.13
145 0.12
146 0.11
147 0.1