Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0H2R1S9

Protein Details
Accession A0A0H2R1S9    Localization Confidence Medium Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
216-246EDIVRRRPIPPRVQERRRRKLHKECVRLLEYBasic
NLS Segment(s)
PositionSequence
220-236RRRPIPPRVQERRRRKL
Subcellular Location(s) nucl 19, mito 3, cyto 3, cyto_mito 3
Family & Domain DBs
Amino Acid Sequences MAATGGINFGLPPPPGARKEQFYDGYADFRQAPQAFEPRNQFYNSNNGVSGGVQQEQRLQRKVTFSASTDGNAEGGHRQQHQFDDTPSFPHSSYSPNRILGLGAHSAAGSPVFYYGRHYSPGGPGLSSTSSPYYSLYSYTSSPYYSPYGTSRYSRPTTTSTATASNLAGPGRNLGRLYTYLGRRLEALMSFLAVSLGFGPDATALRLELAIKRESEDIVRRRPIPPRVQERRRRKLHKECVRLLEYTDAREFTTQFNALTRLLHIASIPQVPDRDVARDALASVQAQMWMQTLRRAIQRRRASYPPGEFQQLWKLVGDLTAVLSSSVRAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.26
3 0.33
4 0.37
5 0.4
6 0.45
7 0.5
8 0.49
9 0.44
10 0.47
11 0.41
12 0.4
13 0.35
14 0.32
15 0.26
16 0.23
17 0.29
18 0.25
19 0.26
20 0.26
21 0.34
22 0.34
23 0.39
24 0.46
25 0.43
26 0.46
27 0.46
28 0.43
29 0.36
30 0.44
31 0.42
32 0.37
33 0.32
34 0.29
35 0.27
36 0.25
37 0.26
38 0.18
39 0.17
40 0.16
41 0.16
42 0.23
43 0.3
44 0.36
45 0.37
46 0.37
47 0.38
48 0.42
49 0.45
50 0.43
51 0.38
52 0.34
53 0.34
54 0.32
55 0.29
56 0.26
57 0.23
58 0.17
59 0.14
60 0.13
61 0.11
62 0.12
63 0.15
64 0.17
65 0.18
66 0.2
67 0.23
68 0.27
69 0.26
70 0.26
71 0.29
72 0.26
73 0.28
74 0.27
75 0.26
76 0.22
77 0.22
78 0.2
79 0.21
80 0.25
81 0.29
82 0.31
83 0.3
84 0.31
85 0.3
86 0.29
87 0.22
88 0.21
89 0.15
90 0.12
91 0.11
92 0.1
93 0.09
94 0.09
95 0.08
96 0.05
97 0.04
98 0.05
99 0.06
100 0.06
101 0.11
102 0.14
103 0.15
104 0.17
105 0.18
106 0.18
107 0.2
108 0.25
109 0.2
110 0.17
111 0.16
112 0.16
113 0.16
114 0.15
115 0.14
116 0.11
117 0.11
118 0.11
119 0.12
120 0.12
121 0.11
122 0.12
123 0.12
124 0.12
125 0.12
126 0.14
127 0.13
128 0.13
129 0.12
130 0.14
131 0.14
132 0.13
133 0.14
134 0.14
135 0.17
136 0.18
137 0.2
138 0.21
139 0.25
140 0.27
141 0.26
142 0.27
143 0.27
144 0.29
145 0.29
146 0.28
147 0.23
148 0.22
149 0.22
150 0.2
151 0.16
152 0.13
153 0.12
154 0.1
155 0.09
156 0.07
157 0.08
158 0.08
159 0.09
160 0.09
161 0.08
162 0.09
163 0.1
164 0.13
165 0.16
166 0.17
167 0.21
168 0.22
169 0.22
170 0.21
171 0.21
172 0.19
173 0.14
174 0.14
175 0.08
176 0.08
177 0.08
178 0.07
179 0.06
180 0.05
181 0.05
182 0.04
183 0.04
184 0.03
185 0.03
186 0.03
187 0.04
188 0.05
189 0.05
190 0.05
191 0.05
192 0.05
193 0.06
194 0.06
195 0.08
196 0.11
197 0.12
198 0.12
199 0.13
200 0.14
201 0.14
202 0.17
203 0.23
204 0.26
205 0.32
206 0.36
207 0.36
208 0.39
209 0.46
210 0.51
211 0.52
212 0.56
213 0.6
214 0.66
215 0.75
216 0.82
217 0.85
218 0.87
219 0.89
220 0.89
221 0.88
222 0.89
223 0.9
224 0.9
225 0.88
226 0.84
227 0.82
228 0.75
229 0.65
230 0.56
231 0.53
232 0.43
233 0.37
234 0.32
235 0.24
236 0.22
237 0.23
238 0.23
239 0.16
240 0.2
241 0.17
242 0.16
243 0.17
244 0.18
245 0.18
246 0.17
247 0.16
248 0.15
249 0.14
250 0.14
251 0.12
252 0.11
253 0.14
254 0.15
255 0.15
256 0.15
257 0.15
258 0.16
259 0.19
260 0.19
261 0.19
262 0.18
263 0.19
264 0.18
265 0.17
266 0.17
267 0.15
268 0.15
269 0.12
270 0.12
271 0.11
272 0.11
273 0.11
274 0.11
275 0.11
276 0.12
277 0.12
278 0.15
279 0.17
280 0.21
281 0.29
282 0.38
283 0.44
284 0.52
285 0.62
286 0.64
287 0.69
288 0.71
289 0.7
290 0.7
291 0.7
292 0.67
293 0.61
294 0.61
295 0.54
296 0.51
297 0.53
298 0.47
299 0.4
300 0.33
301 0.29
302 0.24
303 0.24
304 0.21
305 0.12
306 0.1
307 0.1
308 0.1
309 0.09
310 0.09