Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0H2QY67

Protein Details
Accession A0A0H2QY67   
Localization Confidence Low
Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
181-213WEAERDLAKRMKRRPKWNKPKKGKQPGPAPKPKBasic
NLS Segment(s)
PositionSequence
188-213AKRMKRRPKWNKPKKGKQPGPAPKPK
Subcellular Location(s) mito 21.5, cyto_mito 11.5, nucl 5
Family & Domain DBs
Amino Acid Sequences KRTSAFLVSSSPIKAANPVPFQPPSRLSAPPTVPERLLTLVPENVWEEKLQETLIEFIRITTEQYKMLVNMQAGLVLQNIYCKRLRSQLFAKEKEKAKSIPKATGRLAVDGLPRCLTADDFVQRVQAFVERQLEEAAQKEQRRSAWEEYSKAMKEWTRIDKLRIESNKLLTAKYKADVALWEAERDLAKRMKRRPKWNKPKKGKQPGPAPKPK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.22
3 0.28
4 0.3
5 0.32
6 0.36
7 0.39
8 0.42
9 0.43
10 0.41
11 0.37
12 0.36
13 0.37
14 0.35
15 0.39
16 0.39
17 0.4
18 0.41
19 0.4
20 0.36
21 0.34
22 0.33
23 0.27
24 0.24
25 0.2
26 0.19
27 0.17
28 0.16
29 0.17
30 0.17
31 0.16
32 0.16
33 0.14
34 0.13
35 0.12
36 0.13
37 0.11
38 0.09
39 0.09
40 0.11
41 0.12
42 0.12
43 0.11
44 0.1
45 0.12
46 0.12
47 0.14
48 0.13
49 0.14
50 0.13
51 0.14
52 0.15
53 0.14
54 0.16
55 0.15
56 0.13
57 0.12
58 0.11
59 0.11
60 0.1
61 0.1
62 0.08
63 0.05
64 0.05
65 0.09
66 0.1
67 0.12
68 0.14
69 0.15
70 0.16
71 0.24
72 0.27
73 0.28
74 0.35
75 0.42
76 0.49
77 0.54
78 0.54
79 0.53
80 0.56
81 0.51
82 0.48
83 0.43
84 0.4
85 0.42
86 0.42
87 0.43
88 0.41
89 0.44
90 0.41
91 0.43
92 0.37
93 0.3
94 0.28
95 0.22
96 0.22
97 0.19
98 0.19
99 0.13
100 0.13
101 0.12
102 0.12
103 0.1
104 0.07
105 0.09
106 0.1
107 0.11
108 0.11
109 0.13
110 0.12
111 0.12
112 0.12
113 0.12
114 0.11
115 0.12
116 0.17
117 0.15
118 0.16
119 0.16
120 0.16
121 0.14
122 0.15
123 0.16
124 0.17
125 0.18
126 0.19
127 0.21
128 0.23
129 0.27
130 0.31
131 0.32
132 0.36
133 0.38
134 0.39
135 0.39
136 0.43
137 0.39
138 0.34
139 0.33
140 0.26
141 0.26
142 0.31
143 0.35
144 0.38
145 0.39
146 0.42
147 0.45
148 0.46
149 0.51
150 0.48
151 0.48
152 0.44
153 0.45
154 0.49
155 0.44
156 0.42
157 0.36
158 0.36
159 0.32
160 0.29
161 0.27
162 0.2
163 0.2
164 0.21
165 0.2
166 0.23
167 0.21
168 0.2
169 0.18
170 0.2
171 0.2
172 0.2
173 0.22
174 0.22
175 0.28
176 0.36
177 0.46
178 0.55
179 0.64
180 0.74
181 0.8
182 0.86
183 0.91
184 0.93
185 0.95
186 0.95
187 0.97
188 0.97
189 0.97
190 0.94
191 0.93
192 0.93
193 0.92