Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0H2RM99

Protein Details
Accession A0A0H2RM99    Localization Confidence Low Confidence Score 7.3
NoLS Segment(s)
PositionSequenceProtein Nature
48-69NPYERRSCKKCKSQTSQNGAKYHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 12.666, nucl 12.5, mito 12.5, cyto_nucl 7.833, cyto_mito 7.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR019367  PDZ-binding_CRIPT  
Gene Ontology GO:0005737  C:cytoplasm  
Pfam View protein in Pfam  
PF10235  Cript  
Amino Acid Sequences MVCKKCESKTSKLAAPDPFASSSSAIKSGSRKVGDNKLLRKGGGGKANPYERRSCKKCKSQTSQNGAKYCHNCAFKSGLCSICGHKILDTSGYSMSTK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.54
3 0.48
4 0.41
5 0.36
6 0.32
7 0.28
8 0.24
9 0.21
10 0.18
11 0.17
12 0.15
13 0.16
14 0.18
15 0.22
16 0.27
17 0.27
18 0.28
19 0.32
20 0.4
21 0.46
22 0.49
23 0.49
24 0.5
25 0.5
26 0.46
27 0.43
28 0.38
29 0.35
30 0.35
31 0.31
32 0.26
33 0.3
34 0.36
35 0.38
36 0.36
37 0.38
38 0.37
39 0.45
40 0.48
41 0.53
42 0.55
43 0.62
44 0.69
45 0.73
46 0.76
47 0.78
48 0.82
49 0.82
50 0.82
51 0.78
52 0.73
53 0.66
54 0.64
55 0.56
56 0.5
57 0.48
58 0.43
59 0.37
60 0.35
61 0.38
62 0.32
63 0.34
64 0.34
65 0.29
66 0.27
67 0.28
68 0.28
69 0.29
70 0.3
71 0.26
72 0.23
73 0.22
74 0.23
75 0.24
76 0.22
77 0.19
78 0.18