Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0H2RQD7

Protein Details
Accession A0A0H2RQD7    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
89-114PGGRGEKMRMRKANKQRIKEQNFLKTHydrophilic
NLS Segment(s)
PositionSequence
93-103GEKMRMRKANK
Subcellular Location(s) mito 24.5, cyto_mito 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MLSRAAFGLALLRRRTCFIRTYSDSAKPLSTPKEKGTSEKILSSCPENTVLAGLNYLKDQPPVVAKADSEYPEWLWKLIETKEIPNDGPGGRGEKMRMRKANKQRIKEQNFLKTQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.35
3 0.31
4 0.33
5 0.31
6 0.37
7 0.4
8 0.46
9 0.48
10 0.51
11 0.5
12 0.46
13 0.43
14 0.35
15 0.33
16 0.34
17 0.34
18 0.32
19 0.34
20 0.4
21 0.4
22 0.43
23 0.45
24 0.45
25 0.41
26 0.42
27 0.39
28 0.33
29 0.33
30 0.31
31 0.25
32 0.19
33 0.19
34 0.14
35 0.13
36 0.12
37 0.11
38 0.08
39 0.08
40 0.07
41 0.06
42 0.06
43 0.07
44 0.06
45 0.06
46 0.06
47 0.06
48 0.08
49 0.1
50 0.11
51 0.11
52 0.11
53 0.12
54 0.14
55 0.15
56 0.14
57 0.14
58 0.13
59 0.15
60 0.15
61 0.14
62 0.12
63 0.11
64 0.14
65 0.13
66 0.19
67 0.18
68 0.21
69 0.24
70 0.26
71 0.26
72 0.23
73 0.25
74 0.19
75 0.19
76 0.17
77 0.17
78 0.16
79 0.18
80 0.2
81 0.25
82 0.33
83 0.41
84 0.49
85 0.52
86 0.61
87 0.71
88 0.79
89 0.81
90 0.8
91 0.81
92 0.84
93 0.85
94 0.83
95 0.81