Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0H2RGS8

Protein Details
Accession A0A0H2RGS8    Localization Confidence High Confidence Score 15.8
NoLS Segment(s)
PositionSequenceProtein Nature
21-60REEPVPPSKLPKKSRKGSPVPLKKRGRPATKKAKSVKSKDBasic
NLS Segment(s)
PositionSequence
27-57PSKLPKKSRKGSPVPLKKRGRPATKKAKSVK
114-116KRR
Subcellular Location(s) nucl 22, cyto_nucl 13, mito 3
Family & Domain DBs
Amino Acid Sequences MPPKARRKTADPTLSSPLSVREEPVPPSKLPKKSRKGSPVPLKKRGRPATKKAKSVKSKDTISDSGESDAAPSVSGEESDQTHSDAELPPVTPVKKEKVSVGRVTRSSKSAGEKRRRSEASALGDEDEDDQEGEGDDDAKMRLATESITDSDSDGEEEQEVTPPPKSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.54
3 0.45
4 0.39
5 0.34
6 0.3
7 0.26
8 0.23
9 0.25
10 0.29
11 0.35
12 0.34
13 0.29
14 0.39
15 0.45
16 0.5
17 0.57
18 0.63
19 0.67
20 0.72
21 0.81
22 0.82
23 0.83
24 0.84
25 0.85
26 0.86
27 0.85
28 0.86
29 0.85
30 0.81
31 0.82
32 0.81
33 0.81
34 0.79
35 0.8
36 0.81
37 0.81
38 0.84
39 0.81
40 0.82
41 0.8
42 0.78
43 0.77
44 0.73
45 0.68
46 0.62
47 0.6
48 0.52
49 0.45
50 0.4
51 0.32
52 0.25
53 0.22
54 0.19
55 0.13
56 0.11
57 0.08
58 0.06
59 0.05
60 0.05
61 0.05
62 0.05
63 0.05
64 0.05
65 0.06
66 0.08
67 0.08
68 0.08
69 0.08
70 0.08
71 0.09
72 0.09
73 0.09
74 0.08
75 0.08
76 0.08
77 0.1
78 0.11
79 0.11
80 0.13
81 0.17
82 0.19
83 0.2
84 0.25
85 0.3
86 0.35
87 0.41
88 0.43
89 0.43
90 0.44
91 0.48
92 0.44
93 0.38
94 0.35
95 0.32
96 0.34
97 0.38
98 0.44
99 0.5
100 0.56
101 0.59
102 0.66
103 0.64
104 0.6
105 0.58
106 0.55
107 0.51
108 0.47
109 0.43
110 0.34
111 0.32
112 0.29
113 0.24
114 0.17
115 0.1
116 0.08
117 0.07
118 0.06
119 0.06
120 0.06
121 0.05
122 0.06
123 0.05
124 0.06
125 0.06
126 0.07
127 0.07
128 0.07
129 0.08
130 0.07
131 0.08
132 0.09
133 0.12
134 0.12
135 0.13
136 0.13
137 0.13
138 0.13
139 0.13
140 0.13
141 0.11
142 0.11
143 0.1
144 0.11
145 0.11
146 0.13
147 0.14
148 0.15