Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0H2S7Z4

Protein Details
Accession A0A0H2S7Z4   
Localization Confidence Low
Confidence Score 6.6
NoLS Segment(s)
PositionSequenceProtein Nature
22-52NVFRTRKTYCKGKTCRKHTPHKVTQYKKGKDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 17, nucl 4.5, cyto_nucl 4, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MVNIPKYVYRLFLCELLLILNNVFRTRKTYCKGKTCRKHTPHKVTQYKKGKDSLFAQGKRRYDRKQSGYGGQTKPVFHKKAKTTKKVVLRLECTVCKYKMQLPLKRCKHFELGGDKKTKGAALQF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.2
3 0.16
4 0.16
5 0.13
6 0.11
7 0.1
8 0.11
9 0.12
10 0.13
11 0.12
12 0.17
13 0.21
14 0.29
15 0.33
16 0.42
17 0.48
18 0.58
19 0.68
20 0.74
21 0.8
22 0.8
23 0.85
24 0.84
25 0.86
26 0.87
27 0.87
28 0.86
29 0.86
30 0.87
31 0.82
32 0.84
33 0.84
34 0.78
35 0.71
36 0.68
37 0.58
38 0.52
39 0.49
40 0.48
41 0.47
42 0.46
43 0.49
44 0.48
45 0.51
46 0.53
47 0.55
48 0.5
49 0.5
50 0.55
51 0.54
52 0.56
53 0.55
54 0.55
55 0.54
56 0.57
57 0.49
58 0.44
59 0.41
60 0.34
61 0.37
62 0.39
63 0.38
64 0.33
65 0.4
66 0.44
67 0.53
68 0.61
69 0.64
70 0.63
71 0.67
72 0.74
73 0.74
74 0.73
75 0.7
76 0.65
77 0.62
78 0.6
79 0.55
80 0.5
81 0.47
82 0.41
83 0.35
84 0.34
85 0.34
86 0.39
87 0.46
88 0.48
89 0.51
90 0.61
91 0.69
92 0.73
93 0.71
94 0.66
95 0.64
96 0.6
97 0.6
98 0.6
99 0.59
100 0.6
101 0.62
102 0.57
103 0.51
104 0.49
105 0.42