Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0H2S5A2

Protein Details
Accession A0A0H2S5A2   
Localization Confidence Low
Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
86-116VATSERKNRRTSIRRKKRCKSDRDVVKKSVPHydrophilic
NLS Segment(s)
PositionSequence
91-105RKNRRTSIRRKKRCK
Subcellular Location(s) mito 18.5, cyto_mito 10.5, nucl 5
Family & Domain DBs
Amino Acid Sequences MKSSKSRKWPGLLLSSVEFWLRLSLHTAAISSTHAARTRTCARSSALAQEHPNPPPSEFRNPRFFRRSGMFCAQTTFFSMGGWRVVATSERKNRRTSIRRKKRCKSDRDVVKKSVP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.39
3 0.34
4 0.28
5 0.22
6 0.14
7 0.14
8 0.11
9 0.1
10 0.12
11 0.13
12 0.14
13 0.14
14 0.14
15 0.12
16 0.12
17 0.13
18 0.1
19 0.1
20 0.11
21 0.14
22 0.15
23 0.15
24 0.22
25 0.29
26 0.31
27 0.32
28 0.31
29 0.29
30 0.33
31 0.33
32 0.34
33 0.29
34 0.28
35 0.28
36 0.31
37 0.32
38 0.29
39 0.31
40 0.24
41 0.23
42 0.24
43 0.27
44 0.32
45 0.35
46 0.38
47 0.46
48 0.48
49 0.54
50 0.54
51 0.51
52 0.45
53 0.45
54 0.44
55 0.4
56 0.43
57 0.39
58 0.34
59 0.36
60 0.33
61 0.27
62 0.26
63 0.21
64 0.15
65 0.12
66 0.12
67 0.11
68 0.1
69 0.1
70 0.08
71 0.06
72 0.07
73 0.11
74 0.15
75 0.23
76 0.32
77 0.41
78 0.44
79 0.48
80 0.53
81 0.61
82 0.67
83 0.69
84 0.71
85 0.74
86 0.81
87 0.89
88 0.94
89 0.94
90 0.93
91 0.92
92 0.91
93 0.9
94 0.9
95 0.9
96 0.87