Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0H2RNS1

Protein Details
Accession A0A0H2RNS1    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
55-84HSSGTSLHVRRRRRRRRHPKTRVRSPSLTQBasic
NLS Segment(s)
PositionSequence
64-78RRRRRRRRHPKTRVR
Subcellular Location(s) mito 13.5, nucl 10, cyto_mito 8.666, cyto_nucl 7.333
Family & Domain DBs
Amino Acid Sequences MGEFGLRVRVRAVLSTSSTSTSSPSPSSSPASPSTLRLSISTTQILATIDDDASHSSGTSLHVRRRRRRRRHPKTRVRSPSLTQELACPLKEDYAVKRSCQPIHLFAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.25
3 0.25
4 0.24
5 0.24
6 0.22
7 0.21
8 0.19
9 0.18
10 0.17
11 0.18
12 0.17
13 0.19
14 0.23
15 0.22
16 0.24
17 0.24
18 0.27
19 0.26
20 0.27
21 0.28
22 0.26
23 0.25
24 0.22
25 0.23
26 0.2
27 0.22
28 0.2
29 0.16
30 0.14
31 0.14
32 0.14
33 0.1
34 0.08
35 0.07
36 0.06
37 0.06
38 0.06
39 0.06
40 0.06
41 0.06
42 0.05
43 0.04
44 0.05
45 0.07
46 0.13
47 0.15
48 0.22
49 0.29
50 0.38
51 0.48
52 0.59
53 0.68
54 0.74
55 0.82
56 0.87
57 0.92
58 0.95
59 0.96
60 0.96
61 0.96
62 0.96
63 0.94
64 0.91
65 0.85
66 0.77
67 0.76
68 0.71
69 0.62
70 0.51
71 0.43
72 0.41
73 0.38
74 0.34
75 0.25
76 0.2
77 0.19
78 0.21
79 0.22
80 0.21
81 0.28
82 0.3
83 0.3
84 0.37
85 0.42
86 0.42
87 0.46
88 0.45