Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0H2R9G7

Protein Details
Accession A0A0H2R9G7    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
9-43SLSGWRRRPGRHPAWGRRSRNPPVRARRQPSPKSIHydrophilic
NLS Segment(s)
PositionSequence
14-40RRRPGRHPAWGRRSRNPPVRARRQPSP
Subcellular Location(s) plas 12, mito 11, E.R. 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MAVAAISNSLSGWRRRPGRHPAWGRRSRNPPVRARRQPSPKSIFIRTAILCRSVRQAVGDLEGGASTVIGVIHCKMSVSMSPWYTRTIDSLMRLTLTVHVAHASVIMTVSIILIFILIVVIFIVTNV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.43
3 0.51
4 0.59
5 0.64
6 0.7
7 0.76
8 0.78
9 0.81
10 0.86
11 0.85
12 0.83
13 0.83
14 0.82
15 0.81
16 0.79
17 0.78
18 0.78
19 0.83
20 0.84
21 0.82
22 0.81
23 0.82
24 0.8
25 0.8
26 0.76
27 0.73
28 0.68
29 0.64
30 0.58
31 0.49
32 0.48
33 0.39
34 0.35
35 0.29
36 0.28
37 0.25
38 0.22
39 0.24
40 0.2
41 0.2
42 0.17
43 0.18
44 0.13
45 0.15
46 0.14
47 0.1
48 0.09
49 0.08
50 0.07
51 0.05
52 0.04
53 0.02
54 0.02
55 0.02
56 0.02
57 0.03
58 0.04
59 0.04
60 0.04
61 0.04
62 0.04
63 0.06
64 0.07
65 0.1
66 0.13
67 0.14
68 0.16
69 0.17
70 0.19
71 0.19
72 0.18
73 0.17
74 0.16
75 0.17
76 0.18
77 0.19
78 0.17
79 0.16
80 0.16
81 0.15
82 0.14
83 0.14
84 0.11
85 0.1
86 0.1
87 0.1
88 0.1
89 0.1
90 0.08
91 0.06
92 0.06
93 0.05
94 0.05
95 0.05
96 0.05
97 0.04
98 0.04
99 0.03
100 0.03
101 0.03
102 0.03
103 0.03
104 0.03
105 0.03
106 0.03
107 0.03