Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0H2RBJ1

Protein Details
Accession A0A0H2RBJ1   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
30-55AEVLSFKKIPPKQRHHSRRDYSECTNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, cyto_nucl 11, mito 7
Family & Domain DBs
Amino Acid Sequences MKILSGVSYYKTLNRFPPRNLVPYDAVNSAEVLSFKKIPPKQRHHSRRDYSECTNRKSYSQKPNAPFRFYHRRQNIYNNPTILDLTKIVSFAVKEKRRRNIYLNYEHIDSAHATNNPFDLNIGRAEDRSHTTPGGGHHWHIGILMQKSGRACGEGLRLGLARSVLWPCNVAMSDSGRQSDAKKNLQSSETSPQCASCSPCEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.48
3 0.5
4 0.59
5 0.58
6 0.61
7 0.6
8 0.55
9 0.48
10 0.45
11 0.45
12 0.36
13 0.31
14 0.25
15 0.23
16 0.18
17 0.16
18 0.13
19 0.11
20 0.13
21 0.15
22 0.15
23 0.24
24 0.29
25 0.38
26 0.48
27 0.56
28 0.64
29 0.73
30 0.82
31 0.83
32 0.89
33 0.87
34 0.87
35 0.85
36 0.81
37 0.78
38 0.78
39 0.75
40 0.69
41 0.67
42 0.58
43 0.54
44 0.55
45 0.56
46 0.57
47 0.61
48 0.64
49 0.64
50 0.73
51 0.73
52 0.69
53 0.62
54 0.59
55 0.6
56 0.55
57 0.59
58 0.56
59 0.57
60 0.56
61 0.65
62 0.67
63 0.62
64 0.62
65 0.52
66 0.45
67 0.4
68 0.37
69 0.27
70 0.18
71 0.13
72 0.1
73 0.09
74 0.08
75 0.08
76 0.08
77 0.08
78 0.11
79 0.2
80 0.26
81 0.33
82 0.4
83 0.48
84 0.53
85 0.57
86 0.58
87 0.58
88 0.59
89 0.59
90 0.58
91 0.51
92 0.47
93 0.43
94 0.37
95 0.28
96 0.21
97 0.14
98 0.13
99 0.12
100 0.12
101 0.12
102 0.12
103 0.12
104 0.11
105 0.09
106 0.07
107 0.07
108 0.08
109 0.09
110 0.09
111 0.09
112 0.1
113 0.12
114 0.15
115 0.16
116 0.17
117 0.15
118 0.15
119 0.17
120 0.18
121 0.22
122 0.2
123 0.18
124 0.18
125 0.18
126 0.18
127 0.16
128 0.15
129 0.14
130 0.13
131 0.15
132 0.14
133 0.15
134 0.15
135 0.17
136 0.16
137 0.12
138 0.12
139 0.12
140 0.16
141 0.16
142 0.16
143 0.16
144 0.16
145 0.15
146 0.16
147 0.13
148 0.09
149 0.1
150 0.13
151 0.13
152 0.13
153 0.14
154 0.13
155 0.16
156 0.16
157 0.15
158 0.14
159 0.18
160 0.21
161 0.22
162 0.23
163 0.21
164 0.22
165 0.25
166 0.32
167 0.35
168 0.39
169 0.43
170 0.46
171 0.49
172 0.5
173 0.5
174 0.46
175 0.49
176 0.45
177 0.43
178 0.39
179 0.36
180 0.36
181 0.36
182 0.35