Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0H2R1D5

Protein Details
Accession A0A0H2R1D5    Localization Confidence High Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
70-96LGTLNKAQKHSRYRRRLRTGQQRHLTSHydrophilic
NLS Segment(s)
PositionSequence
77-85QKHSRYRRR
Subcellular Location(s) nucl 23, cyto 2
Family & Domain DBs
Amino Acid Sequences MKKWLDLQFDELRRQMKQDNIISEEQERLNSLIADIARQKKFMVDDKLAFERQQSARRRAVIRASQKLRLGTLNKAQKHSRYRRRLRTGQQRHLTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.37
3 0.34
4 0.38
5 0.4
6 0.4
7 0.42
8 0.43
9 0.41
10 0.37
11 0.35
12 0.27
13 0.22
14 0.18
15 0.14
16 0.14
17 0.12
18 0.1
19 0.1
20 0.09
21 0.1
22 0.14
23 0.2
24 0.2
25 0.21
26 0.21
27 0.2
28 0.23
29 0.27
30 0.28
31 0.24
32 0.26
33 0.29
34 0.32
35 0.3
36 0.28
37 0.22
38 0.22
39 0.23
40 0.29
41 0.32
42 0.34
43 0.38
44 0.43
45 0.44
46 0.42
47 0.46
48 0.46
49 0.49
50 0.53
51 0.53
52 0.53
53 0.54
54 0.52
55 0.45
56 0.43
57 0.37
58 0.33
59 0.38
60 0.42
61 0.42
62 0.46
63 0.49
64 0.52
65 0.6
66 0.66
67 0.68
68 0.7
69 0.78
70 0.84
71 0.89
72 0.91
73 0.91
74 0.91
75 0.92
76 0.91