Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0W4ZVP9

Protein Details
Accession A0A0W4ZVP9    Localization Confidence Low Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
49-70DTEAQLKRKRFRNSLKIRVDRLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 8, mito 6, cyto 5, pero 5, cyto_pero 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027417  P-loop_NTPase  
IPR005225  Small_GTP-bd_dom  
IPR006689  Small_GTPase_ARF/SAR  
IPR006687  Small_GTPase_SAR1  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0012507  C:ER to Golgi transport vesicle membrane  
GO:0000139  C:Golgi membrane  
GO:0005525  F:GTP binding  
GO:0003924  F:GTPase activity  
GO:0006886  P:intracellular protein transport  
Pfam View protein in Pfam  
PF00025  Arf  
PROSITE View protein in PROSITE  
PS51417  ARF  
PS51422  SAR1  
CDD cd00879  Sar1  
Amino Acid Sequences MFIIHWFCDILASLGLMNKHAKLLFLGLDNAGKTTLLHMLKVSIQAYRDTEAQLKRKRFRNSLKIRVDRLVLFQPTLHPTSEELAIGNCRFTTFDLGGHQQARRLWRDYFPDVNGIVFLVDSADVDRLCESKLELDALLSMEELSKVPFLVLGNKIDAPGAISEEELRGFLGLYQTTGKGKTICENVRPIEVFMCSVVMRQGYGEGFRWLSQYV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.13
4 0.14
5 0.13
6 0.16
7 0.16
8 0.15
9 0.14
10 0.16
11 0.16
12 0.15
13 0.16
14 0.14
15 0.16
16 0.16
17 0.15
18 0.13
19 0.11
20 0.09
21 0.1
22 0.16
23 0.14
24 0.15
25 0.15
26 0.16
27 0.17
28 0.21
29 0.2
30 0.15
31 0.15
32 0.17
33 0.19
34 0.2
35 0.19
36 0.18
37 0.23
38 0.28
39 0.36
40 0.41
41 0.48
42 0.54
43 0.61
44 0.67
45 0.71
46 0.74
47 0.76
48 0.79
49 0.81
50 0.83
51 0.82
52 0.77
53 0.7
54 0.62
55 0.52
56 0.45
57 0.4
58 0.3
59 0.24
60 0.21
61 0.21
62 0.21
63 0.22
64 0.18
65 0.14
66 0.14
67 0.15
68 0.16
69 0.13
70 0.1
71 0.09
72 0.11
73 0.1
74 0.1
75 0.08
76 0.07
77 0.08
78 0.08
79 0.11
80 0.1
81 0.11
82 0.13
83 0.15
84 0.17
85 0.19
86 0.18
87 0.17
88 0.18
89 0.21
90 0.21
91 0.23
92 0.22
93 0.23
94 0.29
95 0.3
96 0.31
97 0.28
98 0.27
99 0.24
100 0.22
101 0.18
102 0.13
103 0.09
104 0.06
105 0.05
106 0.03
107 0.03
108 0.03
109 0.03
110 0.04
111 0.04
112 0.05
113 0.05
114 0.06
115 0.06
116 0.06
117 0.06
118 0.07
119 0.08
120 0.08
121 0.08
122 0.07
123 0.08
124 0.08
125 0.07
126 0.06
127 0.05
128 0.05
129 0.05
130 0.05
131 0.05
132 0.05
133 0.05
134 0.05
135 0.06
136 0.07
137 0.11
138 0.13
139 0.14
140 0.16
141 0.16
142 0.16
143 0.15
144 0.14
145 0.11
146 0.09
147 0.09
148 0.07
149 0.07
150 0.08
151 0.09
152 0.09
153 0.08
154 0.07
155 0.06
156 0.06
157 0.06
158 0.08
159 0.08
160 0.09
161 0.1
162 0.12
163 0.14
164 0.15
165 0.16
166 0.15
167 0.17
168 0.22
169 0.29
170 0.32
171 0.35
172 0.41
173 0.41
174 0.45
175 0.44
176 0.39
177 0.32
178 0.29
179 0.24
180 0.19
181 0.18
182 0.13
183 0.12
184 0.13
185 0.12
186 0.11
187 0.11
188 0.13
189 0.13
190 0.15
191 0.16
192 0.17
193 0.19
194 0.19