Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0W4ZCU2

Protein Details
Accession A0A0W4ZCU2   
Localization Confidence Medium
Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
2-33VNIPKLRRTFCKGKECRRHTQHKVTQYKKGKDHydrophilic
NLS Segment(s)
PositionSequence
40-64KRRYDRKQRGYGGQTKQIFRKKAKT
Subcellular Location(s) nucl 12.5, mito 10, cyto_nucl 9, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MVNIPKLRRTFCKGKECRRHTQHKVTQYKKGKDSLYAQGKRRYDRKQRGYGGQTKQIFRKKAKTTKKVVLKLECTVCKHKTQVPLKRCKHFELGGDKKTKGAALVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.84
3 0.84
4 0.86
5 0.85
6 0.87
7 0.85
8 0.86
9 0.83
10 0.83
11 0.86
12 0.8
13 0.81
14 0.8
15 0.78
16 0.71
17 0.69
18 0.6
19 0.54
20 0.54
21 0.53
22 0.54
23 0.53
24 0.54
25 0.55
26 0.58
27 0.58
28 0.6
29 0.6
30 0.61
31 0.65
32 0.68
33 0.7
34 0.71
35 0.73
36 0.72
37 0.71
38 0.64
39 0.61
40 0.55
41 0.48
42 0.51
43 0.49
44 0.48
45 0.43
46 0.49
47 0.5
48 0.57
49 0.65
50 0.67
51 0.68
52 0.72
53 0.78
54 0.76
55 0.74
56 0.71
57 0.64
58 0.61
59 0.6
60 0.55
61 0.5
62 0.49
63 0.45
64 0.42
65 0.42
66 0.41
67 0.45
68 0.51
69 0.56
70 0.59
71 0.68
72 0.72
73 0.77
74 0.76
75 0.71
76 0.68
77 0.62
78 0.6
79 0.6
80 0.61
81 0.6
82 0.61
83 0.56
84 0.51
85 0.48
86 0.42