Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0W4ZP08

Protein Details
Accession A0A0W4ZP08    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
2-49SGSSLHPKIIKKRTKRFVRHQSDRYKCIAPSWRKPKGIDNRVRRRFKGHydrophilic
NLS Segment(s)
PositionSequence
11-19IKKRTKRFV
32-50SWRKPKGIDNRVRRRFKGQ
Subcellular Location(s) nucl 14, mito_nucl 12.833, mito 10.5, cyto_nucl 8.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MSGSSLHPKIIKKRTKRFVRHQSDRYKCIAPSWRKPKGIDNRVRRRFKGQIAMPRIGYGSDKRTRHMRPGGRYTFLIRNISDVDVLLMHNQTYIGEIASTVSSRKRILIAEKAMKLGVKLTNGTARARPQE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.84
3 0.88
4 0.89
5 0.9
6 0.92
7 0.91
8 0.9
9 0.9
10 0.87
11 0.81
12 0.75
13 0.67
14 0.56
15 0.53
16 0.54
17 0.51
18 0.54
19 0.59
20 0.63
21 0.63
22 0.65
23 0.68
24 0.69
25 0.71
26 0.7
27 0.71
28 0.74
29 0.8
30 0.84
31 0.77
32 0.73
33 0.69
34 0.65
35 0.63
36 0.58
37 0.57
38 0.57
39 0.57
40 0.49
41 0.43
42 0.37
43 0.28
44 0.24
45 0.17
46 0.18
47 0.23
48 0.23
49 0.25
50 0.32
51 0.33
52 0.39
53 0.45
54 0.45
55 0.44
56 0.53
57 0.54
58 0.49
59 0.48
60 0.45
61 0.42
62 0.38
63 0.34
64 0.25
65 0.24
66 0.23
67 0.22
68 0.18
69 0.13
70 0.1
71 0.08
72 0.08
73 0.07
74 0.06
75 0.06
76 0.06
77 0.06
78 0.05
79 0.06
80 0.06
81 0.05
82 0.05
83 0.05
84 0.06
85 0.07
86 0.07
87 0.07
88 0.09
89 0.12
90 0.13
91 0.14
92 0.16
93 0.19
94 0.25
95 0.32
96 0.38
97 0.44
98 0.44
99 0.44
100 0.43
101 0.4
102 0.34
103 0.3
104 0.24
105 0.19
106 0.19
107 0.21
108 0.26
109 0.28
110 0.31
111 0.32