Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0W4ZWS0

Protein Details
Accession A0A0W4ZWS0    Localization Confidence Low Confidence Score 6.8
NoLS Segment(s)
PositionSequenceProtein Nature
4-30ERLLHNKLCKSKHNKYKKRKLFLCGFHHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21, nucl 5.5, cyto_nucl 3.5
Family & Domain DBs
Amino Acid Sequences MCLERLLHNKLCKSKHNKYKKRKLFLCGFHIKRSPEVLFFGTKEIPAIVLSPPTTADTSCFI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.71
3 0.76
4 0.8
5 0.84
6 0.9
7 0.9
8 0.91
9 0.86
10 0.84
11 0.81
12 0.77
13 0.74
14 0.73
15 0.65
16 0.59
17 0.57
18 0.51
19 0.43
20 0.4
21 0.32
22 0.24
23 0.23
24 0.21
25 0.19
26 0.18
27 0.19
28 0.16
29 0.15
30 0.14
31 0.11
32 0.1
33 0.08
34 0.09
35 0.07
36 0.1
37 0.1
38 0.1
39 0.11
40 0.13
41 0.14
42 0.13