Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0W4ZUN0

Protein Details
Accession A0A0W4ZUN0    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
64-88VMIKSNSLKLKKKKNQSINHIKAYHHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, cyto_nucl 7, E.R. 5, plas 4, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR009914  DPM2  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0030234  F:enzyme regulator activity  
GO:0019348  P:dolichol metabolic process  
GO:0006486  P:protein glycosylation  
Pfam View protein in Pfam  
PF07297  DPM2  
Amino Acid Sequences MDFNNGKPNFSYQYNKKRSNVLKPFVDKDHPLHSFFFPREWAIRIPVILLLTCFVIVTSFMAIVMIKSNSLKLKKKKNQSINHIKAYHLPIS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.66
3 0.64
4 0.69
5 0.71
6 0.73
7 0.73
8 0.69
9 0.67
10 0.65
11 0.67
12 0.62
13 0.58
14 0.5
15 0.44
16 0.44
17 0.38
18 0.35
19 0.33
20 0.31
21 0.31
22 0.29
23 0.26
24 0.2
25 0.19
26 0.19
27 0.19
28 0.18
29 0.16
30 0.15
31 0.14
32 0.13
33 0.12
34 0.11
35 0.08
36 0.07
37 0.06
38 0.05
39 0.05
40 0.05
41 0.04
42 0.03
43 0.04
44 0.04
45 0.04
46 0.04
47 0.04
48 0.04
49 0.04
50 0.04
51 0.06
52 0.06
53 0.07
54 0.07
55 0.1
56 0.16
57 0.24
58 0.33
59 0.4
60 0.51
61 0.6
62 0.7
63 0.78
64 0.83
65 0.85
66 0.87
67 0.9
68 0.87
69 0.88
70 0.78
71 0.69
72 0.65