Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0W4ZHI6

Protein Details
Accession A0A0W4ZHI6   
Localization Confidence Medium
Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
44-76VQCLSKERLKQQRANQKKKKEKRQNAEISKEDQHydrophilic
NLS Segment(s)
PositionSequence
53-66KQQRANQKKKKEKR
Subcellular Location(s) nucl 20, cyto_nucl 14.333, cyto 4.5, cyto_pero 3.332
Family & Domain DBs
InterPro View protein in InterPro  
IPR013892  Cyt_c_biogenesis_Cmc1-like  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
Pfam View protein in Pfam  
PF08583  Cmc1  
PROSITE View protein in PROSITE  
PS51808  CHCH  
Amino Acid Sequences MHPPISAHKHPDCYEIMQELEKCHKSGFFNYFLGKCNNLKKDVVQCLSKERLKQQRANQKKKKEKRQNAEISKEDQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.33
3 0.29
4 0.26
5 0.26
6 0.24
7 0.29
8 0.27
9 0.24
10 0.23
11 0.24
12 0.23
13 0.28
14 0.3
15 0.26
16 0.26
17 0.29
18 0.29
19 0.29
20 0.28
21 0.25
22 0.24
23 0.27
24 0.27
25 0.27
26 0.26
27 0.27
28 0.32
29 0.36
30 0.36
31 0.31
32 0.3
33 0.33
34 0.39
35 0.39
36 0.35
37 0.38
38 0.45
39 0.49
40 0.56
41 0.6
42 0.65
43 0.73
44 0.81
45 0.82
46 0.83
47 0.87
48 0.9
49 0.93
50 0.93
51 0.93
52 0.92
53 0.94
54 0.94
55 0.92
56 0.9