Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0W4ZGH1

Protein Details
Accession A0A0W4ZGH1    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
45-83QPSNRVRKRRHGFLARKRSVGGRKILARRIAKKRKYLTHBasic
NLS Segment(s)
PositionSequence
49-79RVRKRRHGFLARKRSVGGRKILARRIAKKRK
Subcellular Location(s) mito 17, nucl 8, cyto_nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MLQIQNPIFKSVFFSFQIGKLFLRFFPPIVLLNIKRFRTYGREYQPSNRVRKRRHGFLARKRSVGGRKILARRIAKKRKYLTH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.23
3 0.26
4 0.29
5 0.24
6 0.22
7 0.2
8 0.2
9 0.18
10 0.21
11 0.18
12 0.16
13 0.15
14 0.17
15 0.16
16 0.17
17 0.21
18 0.18
19 0.25
20 0.31
21 0.3
22 0.29
23 0.28
24 0.28
25 0.3
26 0.33
27 0.34
28 0.35
29 0.4
30 0.41
31 0.47
32 0.54
33 0.54
34 0.58
35 0.57
36 0.59
37 0.59
38 0.68
39 0.69
40 0.7
41 0.73
42 0.74
43 0.77
44 0.79
45 0.85
46 0.78
47 0.72
48 0.64
49 0.62
50 0.59
51 0.54
52 0.5
53 0.46
54 0.51
55 0.56
56 0.61
57 0.62
58 0.63
59 0.67
60 0.72
61 0.75
62 0.75
63 0.78