Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A7TP35

Protein Details
Accession A7TP35    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
23-45QLKSYEFSLRNKKKKINLSLDNEHydrophilic
141-172NKNNLNNKIKNKNKNRNKNKKPSQLLKKINPSHydrophilic
NLS Segment(s)
PositionSequence
148-163KIKNKNKNRNKNKKPS
Subcellular Location(s) mito 9, plas 8, nucl 3, pero 3, cyto 2, E.R. 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG vpo:Kpol_1044p1  -  
Amino Acid Sequences MKMNFNCTLLLTGLSMFLYNFEQLKSYEFSLRNKKKKINLSLDNELENFIISILNSASLYLLVYTVISMLYWRFFVPIYILALSFIGLNSFFIIWLQSMLHINFLTLFIVKQLEISQNQCKNHNLNLDLSLHSSSIIQQENKNNLNNKIKNKNKNRNKNKKPSQLLKKINPSILIITTLEFLYKISFIAFTSLLSLVPFIGPLTAFYHLFIKFKRKRVSNLYHKDLKIYKNNNKNLTTTTITNASSPNIKQETNILTNSVKFLINRWISFLSYSLVFLFGIDITNSSNKKSGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.1
3 0.08
4 0.09
5 0.1
6 0.11
7 0.12
8 0.11
9 0.13
10 0.13
11 0.17
12 0.18
13 0.19
14 0.25
15 0.28
16 0.36
17 0.46
18 0.56
19 0.62
20 0.67
21 0.72
22 0.74
23 0.8
24 0.82
25 0.82
26 0.81
27 0.79
28 0.79
29 0.74
30 0.67
31 0.57
32 0.47
33 0.37
34 0.27
35 0.19
36 0.1
37 0.08
38 0.06
39 0.07
40 0.06
41 0.07
42 0.06
43 0.06
44 0.06
45 0.06
46 0.06
47 0.05
48 0.05
49 0.04
50 0.04
51 0.04
52 0.04
53 0.04
54 0.04
55 0.04
56 0.05
57 0.06
58 0.06
59 0.07
60 0.07
61 0.07
62 0.08
63 0.09
64 0.11
65 0.12
66 0.12
67 0.12
68 0.11
69 0.11
70 0.11
71 0.09
72 0.07
73 0.05
74 0.04
75 0.05
76 0.05
77 0.05
78 0.05
79 0.04
80 0.05
81 0.05
82 0.05
83 0.05
84 0.06
85 0.08
86 0.08
87 0.1
88 0.09
89 0.09
90 0.09
91 0.09
92 0.08
93 0.07
94 0.06
95 0.05
96 0.06
97 0.06
98 0.06
99 0.08
100 0.1
101 0.12
102 0.16
103 0.23
104 0.27
105 0.29
106 0.31
107 0.32
108 0.32
109 0.35
110 0.35
111 0.29
112 0.25
113 0.26
114 0.25
115 0.22
116 0.21
117 0.17
118 0.13
119 0.11
120 0.1
121 0.09
122 0.11
123 0.13
124 0.13
125 0.16
126 0.21
127 0.26
128 0.29
129 0.32
130 0.31
131 0.35
132 0.43
133 0.45
134 0.47
135 0.52
136 0.57
137 0.64
138 0.72
139 0.76
140 0.78
141 0.83
142 0.88
143 0.89
144 0.91
145 0.92
146 0.92
147 0.91
148 0.89
149 0.88
150 0.87
151 0.86
152 0.84
153 0.8
154 0.79
155 0.72
156 0.65
157 0.56
158 0.47
159 0.38
160 0.3
161 0.24
162 0.15
163 0.12
164 0.11
165 0.1
166 0.08
167 0.07
168 0.06
169 0.06
170 0.06
171 0.05
172 0.05
173 0.05
174 0.05
175 0.07
176 0.07
177 0.07
178 0.08
179 0.08
180 0.08
181 0.08
182 0.08
183 0.06
184 0.06
185 0.06
186 0.04
187 0.04
188 0.04
189 0.05
190 0.07
191 0.09
192 0.09
193 0.1
194 0.14
195 0.14
196 0.17
197 0.17
198 0.26
199 0.32
200 0.4
201 0.48
202 0.5
203 0.56
204 0.64
205 0.73
206 0.73
207 0.76
208 0.75
209 0.75
210 0.7
211 0.68
212 0.63
213 0.6
214 0.58
215 0.59
216 0.61
217 0.62
218 0.7
219 0.71
220 0.68
221 0.64
222 0.57
223 0.53
224 0.48
225 0.39
226 0.34
227 0.31
228 0.29
229 0.28
230 0.26
231 0.22
232 0.23
233 0.22
234 0.26
235 0.26
236 0.25
237 0.24
238 0.29
239 0.34
240 0.33
241 0.34
242 0.29
243 0.27
244 0.28
245 0.29
246 0.25
247 0.2
248 0.16
249 0.18
250 0.25
251 0.29
252 0.28
253 0.31
254 0.31
255 0.3
256 0.31
257 0.29
258 0.22
259 0.17
260 0.18
261 0.14
262 0.13
263 0.12
264 0.11
265 0.1
266 0.08
267 0.09
268 0.08
269 0.08
270 0.1
271 0.17
272 0.18
273 0.2