Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0W4ZUJ3

Protein Details
Accession A0A0W4ZUJ3   
Localization Confidence Medium
Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
9-33LSAHKKEVFSRRKCLRCNKFCHFYSHydrophilic
108-133ISSSEEIHHKKKKRRHGNGSGKSGSGBasic
NLS Segment(s)
PositionSequence
116-141HKKKKRRHGNGSGKSGSGKSSHLKTK
Subcellular Location(s) nucl 14.5, mito 10, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR013246  SAGA_su_Sgf11  
Gene Ontology GO:0005634  C:nucleus  
GO:0070461  C:SAGA-type complex  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF08209  Sgf11  
Amino Acid Sequences MELIIDIALSAHKKEVFSRRKCLRCNKFCHFYSIKPGRDIFGKPYQTPSTAPYISCTICKREVAAGRYVPHLEKCFGSGRLSGRLAQQRVNVYNASMSSYANDADNDISSSEEIHHKKKKRRHGNGSGKSGSGKSSHLKTKKTIITSNSSDTDLQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.32
3 0.4
4 0.46
5 0.55
6 0.62
7 0.69
8 0.77
9 0.81
10 0.82
11 0.81
12 0.84
13 0.82
14 0.81
15 0.74
16 0.74
17 0.67
18 0.59
19 0.61
20 0.61
21 0.55
22 0.5
23 0.49
24 0.42
25 0.41
26 0.4
27 0.35
28 0.35
29 0.35
30 0.32
31 0.38
32 0.38
33 0.36
34 0.35
35 0.31
36 0.29
37 0.26
38 0.26
39 0.22
40 0.23
41 0.22
42 0.24
43 0.24
44 0.21
45 0.22
46 0.22
47 0.21
48 0.23
49 0.28
50 0.27
51 0.29
52 0.28
53 0.27
54 0.28
55 0.28
56 0.23
57 0.21
58 0.2
59 0.16
60 0.14
61 0.15
62 0.16
63 0.16
64 0.16
65 0.17
66 0.17
67 0.2
68 0.2
69 0.19
70 0.22
71 0.26
72 0.26
73 0.26
74 0.27
75 0.27
76 0.27
77 0.28
78 0.23
79 0.18
80 0.18
81 0.16
82 0.14
83 0.11
84 0.1
85 0.08
86 0.09
87 0.09
88 0.09
89 0.09
90 0.07
91 0.07
92 0.08
93 0.08
94 0.07
95 0.07
96 0.07
97 0.07
98 0.08
99 0.15
100 0.18
101 0.25
102 0.34
103 0.42
104 0.51
105 0.59
106 0.69
107 0.73
108 0.81
109 0.84
110 0.87
111 0.9
112 0.9
113 0.91
114 0.81
115 0.71
116 0.62
117 0.52
118 0.42
119 0.33
120 0.27
121 0.24
122 0.28
123 0.37
124 0.42
125 0.45
126 0.48
127 0.56
128 0.59
129 0.6
130 0.59
131 0.55
132 0.56
133 0.57
134 0.58
135 0.51
136 0.46