Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0W4ZRS4

Protein Details
Accession A0A0W4ZRS4    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
23-49DKKEHGKGTLDKKKRSKNRKETYSSYIBasic
NLS Segment(s)
PositionSequence
9-42KPVASKSFSGKAPMDKKEHGKGTLDKKKRSKNRK
Subcellular Location(s) nucl 21, cyto_nucl 13, mito 3, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
IPR007125  Histone_H2A/H2B/H3  
IPR000558  Histone_H2B  
Gene Ontology GO:0000786  C:nucleosome  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046982  F:protein heterodimerization activity  
GO:0030527  F:structural constituent of chromatin  
GO:0006325  P:chromatin organization  
Pfam View protein in Pfam  
PF00125  Histone  
PROSITE View protein in PROSITE  
PS00357  HISTONE_H2B  
Amino Acid Sequences MPQKLAEKKPVASKSFSGKAPMDKKEHGKGTLDKKKRSKNRKETYSSYIYKVLKQVHPDTGISNRAMSILNSFVNDIFERIASEASKLASYNKKSTISSREIQTSVRLILPGELAKHAVSEGTKAVTKYSSSSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.53
3 0.5
4 0.46
5 0.41
6 0.46
7 0.49
8 0.51
9 0.49
10 0.49
11 0.54
12 0.57
13 0.59
14 0.52
15 0.5
16 0.51
17 0.56
18 0.6
19 0.62
20 0.63
21 0.67
22 0.75
23 0.8
24 0.84
25 0.84
26 0.85
27 0.88
28 0.89
29 0.87
30 0.83
31 0.79
32 0.77
33 0.68
34 0.59
35 0.55
36 0.46
37 0.4
38 0.39
39 0.38
40 0.32
41 0.34
42 0.34
43 0.31
44 0.31
45 0.3
46 0.27
47 0.25
48 0.24
49 0.2
50 0.17
51 0.13
52 0.12
53 0.12
54 0.1
55 0.09
56 0.08
57 0.08
58 0.08
59 0.08
60 0.07
61 0.09
62 0.09
63 0.08
64 0.07
65 0.06
66 0.07
67 0.07
68 0.08
69 0.06
70 0.07
71 0.07
72 0.08
73 0.08
74 0.08
75 0.13
76 0.19
77 0.22
78 0.26
79 0.3
80 0.32
81 0.33
82 0.37
83 0.4
84 0.39
85 0.39
86 0.39
87 0.39
88 0.37
89 0.37
90 0.35
91 0.3
92 0.25
93 0.22
94 0.18
95 0.14
96 0.14
97 0.15
98 0.14
99 0.13
100 0.12
101 0.13
102 0.12
103 0.12
104 0.11
105 0.11
106 0.1
107 0.11
108 0.12
109 0.13
110 0.16
111 0.16
112 0.18
113 0.18
114 0.19