Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0W4ZIU1

Protein Details
Accession A0A0W4ZIU1   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
15-43LLWKMPWRLSKTRKLRQRRRLRKVDLVISHydrophilic
NLS Segment(s)
PositionSequence
24-37SKTRKLRQRRRLRK
Subcellular Location(s) mito 23.5, mito_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGPFKTNMPIFSGLLWKMPWRLSKTRKLRQRRRLRKVDLVISTLQNSLAKKGLTCHALERHIREIIPEAKMLPKDKYTVFDKKKKEFRKGIHFVPKFTKVTIMNRMFPPGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.22
3 0.22
4 0.2
5 0.19
6 0.23
7 0.28
8 0.3
9 0.4
10 0.45
11 0.55
12 0.64
13 0.7
14 0.76
15 0.81
16 0.85
17 0.86
18 0.9
19 0.91
20 0.91
21 0.92
22 0.89
23 0.88
24 0.83
25 0.79
26 0.7
27 0.62
28 0.53
29 0.43
30 0.37
31 0.27
32 0.22
33 0.16
34 0.14
35 0.12
36 0.13
37 0.12
38 0.11
39 0.13
40 0.15
41 0.14
42 0.15
43 0.17
44 0.18
45 0.22
46 0.24
47 0.25
48 0.25
49 0.24
50 0.24
51 0.21
52 0.22
53 0.21
54 0.2
55 0.17
56 0.15
57 0.17
58 0.2
59 0.22
60 0.2
61 0.18
62 0.2
63 0.21
64 0.24
65 0.27
66 0.35
67 0.42
68 0.48
69 0.54
70 0.61
71 0.7
72 0.74
73 0.78
74 0.77
75 0.77
76 0.8
77 0.79
78 0.79
79 0.8
80 0.73
81 0.68
82 0.66
83 0.64
84 0.55
85 0.49
86 0.46
87 0.39
88 0.44
89 0.5
90 0.49
91 0.47
92 0.47