Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0W4ZMF3

Protein Details
Accession A0A0W4ZMF3   
Localization Confidence Medium
Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
78-108KADVDRRRRRGKGPPAKSKVKKEAKTAQKKRBasic
NLS Segment(s)
PositionSequence
82-108DRRRRRGKGPPAKSKVKKEAKTAQKKR
Subcellular Location(s) mito 16, nucl 8.5, cyto_nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013219  Ribosomal_S27/S33_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08293  MRP-S33  
Amino Acid Sequences MFKLPSKKRLQEVATVVSRIFGTTFNVDCRRNGNRILRQRFRGPAILDYYSRMDINPKTIIRSFPELKLSDPVEEARKADVDRRRRRGKGPPAKSKVKKEAKTAQKKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.47
3 0.41
4 0.33
5 0.3
6 0.22
7 0.17
8 0.11
9 0.11
10 0.13
11 0.15
12 0.2
13 0.25
14 0.26
15 0.26
16 0.31
17 0.32
18 0.32
19 0.38
20 0.41
21 0.45
22 0.55
23 0.63
24 0.64
25 0.64
26 0.66
27 0.63
28 0.57
29 0.52
30 0.43
31 0.37
32 0.35
33 0.32
34 0.27
35 0.25
36 0.23
37 0.19
38 0.18
39 0.14
40 0.13
41 0.12
42 0.15
43 0.17
44 0.16
45 0.18
46 0.19
47 0.21
48 0.21
49 0.27
50 0.26
51 0.24
52 0.29
53 0.27
54 0.27
55 0.29
56 0.27
57 0.22
58 0.21
59 0.21
60 0.19
61 0.19
62 0.19
63 0.16
64 0.17
65 0.17
66 0.23
67 0.29
68 0.36
69 0.45
70 0.55
71 0.63
72 0.66
73 0.72
74 0.76
75 0.79
76 0.79
77 0.8
78 0.81
79 0.8
80 0.86
81 0.88
82 0.87
83 0.86
84 0.86
85 0.81
86 0.79
87 0.81
88 0.82