Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0W4ZHU3

Protein Details
Accession A0A0W4ZHU3    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MEKHKKKKENKKHLIKSNLSISBasic
NLS Segment(s)
PositionSequence
3-13KHKKKKENKKH
Subcellular Location(s) nucl 14.5, cyto_nucl 10.5, mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR013885  DUF1764_euk  
Pfam View protein in Pfam  
PF08576  DUF1764  
Amino Acid Sequences MEKHKKKKENKKHLIKSNLSISNIDSDLNELKNQITDILKPLKSKTNTKIQVNQKFIKFDECQISELKPLKFKQKTNNETNFTNLKKPIKRKRTEEGFTVYNEEELNIGKGGNTSKCPFDCNCCKIL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.93
2 0.87
3 0.82
4 0.8
5 0.74
6 0.64
7 0.55
8 0.46
9 0.39
10 0.34
11 0.27
12 0.18
13 0.15
14 0.16
15 0.16
16 0.16
17 0.12
18 0.12
19 0.13
20 0.13
21 0.13
22 0.11
23 0.11
24 0.16
25 0.21
26 0.23
27 0.24
28 0.26
29 0.32
30 0.35
31 0.41
32 0.41
33 0.45
34 0.5
35 0.53
36 0.6
37 0.61
38 0.66
39 0.66
40 0.65
41 0.57
42 0.52
43 0.48
44 0.44
45 0.35
46 0.29
47 0.29
48 0.25
49 0.25
50 0.23
51 0.23
52 0.22
53 0.26
54 0.24
55 0.23
56 0.24
57 0.32
58 0.37
59 0.41
60 0.46
61 0.52
62 0.59
63 0.63
64 0.7
65 0.64
66 0.59
67 0.6
68 0.56
69 0.47
70 0.44
71 0.4
72 0.4
73 0.43
74 0.52
75 0.59
76 0.63
77 0.69
78 0.72
79 0.77
80 0.79
81 0.76
82 0.7
83 0.65
84 0.57
85 0.5
86 0.47
87 0.37
88 0.28
89 0.24
90 0.19
91 0.14
92 0.12
93 0.13
94 0.09
95 0.08
96 0.08
97 0.1
98 0.13
99 0.16
100 0.21
101 0.21
102 0.27
103 0.28
104 0.32
105 0.33
106 0.39
107 0.45