Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0W4ZWA7

Protein Details
Accession A0A0W4ZWA7    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
96-129LEEKTERSSRQQRKQRKNRSKKFRGTAKKAAITAHydrophilic
NLS Segment(s)
PositionSequence
102-129RSSRQQRKQRKNRSKKFRGTAKKAAITA
Subcellular Location(s) mito 23.5, mito_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MSDSVTIRTRKFLTNRLLCRKQMIVDILHPSRPNLSRNDLRERLAIMYKVHKDTVQVFGLRTQFGGGKSTGFALIYDSVEMMRKFEPKYRLIRIGLEEKTERSSRQQRKQRKNRSKKFRGTAKKAAITATTKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.65
3 0.7
4 0.74
5 0.67
6 0.67
7 0.61
8 0.52
9 0.48
10 0.41
11 0.33
12 0.3
13 0.36
14 0.33
15 0.34
16 0.32
17 0.28
18 0.3
19 0.31
20 0.3
21 0.27
22 0.33
23 0.37
24 0.42
25 0.51
26 0.48
27 0.46
28 0.44
29 0.41
30 0.36
31 0.32
32 0.28
33 0.21
34 0.24
35 0.26
36 0.26
37 0.25
38 0.23
39 0.22
40 0.22
41 0.25
42 0.21
43 0.19
44 0.17
45 0.2
46 0.2
47 0.19
48 0.16
49 0.12
50 0.12
51 0.11
52 0.13
53 0.09
54 0.09
55 0.09
56 0.09
57 0.09
58 0.07
59 0.06
60 0.06
61 0.07
62 0.07
63 0.07
64 0.06
65 0.06
66 0.09
67 0.09
68 0.09
69 0.1
70 0.13
71 0.14
72 0.2
73 0.25
74 0.28
75 0.35
76 0.39
77 0.43
78 0.42
79 0.43
80 0.42
81 0.44
82 0.4
83 0.37
84 0.33
85 0.28
86 0.31
87 0.3
88 0.27
89 0.29
90 0.39
91 0.45
92 0.54
93 0.63
94 0.69
95 0.79
96 0.89
97 0.92
98 0.92
99 0.94
100 0.94
101 0.95
102 0.95
103 0.94
104 0.93
105 0.93
106 0.93
107 0.9
108 0.9
109 0.88
110 0.83
111 0.74
112 0.66
113 0.6