Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0W4ZRT0

Protein Details
Accession A0A0W4ZRT0    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MAKSKNHTNHNQNKKAHKNGIHRPKVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNHTNHNQNKKAHKNGIHRPKVHRYLSMKHLDLKFRLNCKYAMRGTQRVLKEKRESKII
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.82
3 0.8
4 0.78
5 0.76
6 0.78
7 0.82
8 0.8
9 0.75
10 0.74
11 0.75
12 0.74
13 0.67
14 0.63
15 0.57
16 0.54
17 0.56
18 0.55
19 0.46
20 0.43
21 0.44
22 0.4
23 0.36
24 0.39
25 0.36
26 0.36
27 0.38
28 0.35
29 0.35
30 0.36
31 0.41
32 0.37
33 0.41
34 0.43
35 0.45
36 0.47
37 0.51
38 0.53
39 0.56
40 0.58
41 0.58
42 0.61
43 0.63