Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0W4ZCW6

Protein Details
Accession A0A0W4ZCW6   
Localization Confidence High
Confidence Score 15.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-29MLLAKKGIKQRKKEKKERKKTLEKWLFLFHydrophilic
NLS Segment(s)
PositionSequence
5-36KKGIKQRKKEKKERKKTLEKWLFLFEKKRGGE
52-56RKRKR
Subcellular Location(s) nucl 18.5, cyto_nucl 12.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013865  FAM32A  
Amino Acid Sequences MLLAKKGIKQRKKEKKERKKTLEKWLFLFEKKRGGEPSKYAEKTAPQAYLYRKRKRIAAGVSKAASGAVSGEKIGPDIASVEVPAVSELPLKTPTEQRFEEIWRKRMDERVQKTAAKSHRERVAEFNKKLSELSEHNDIPKVGPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.92
3 0.95
4 0.96
5 0.96
6 0.96
7 0.93
8 0.93
9 0.92
10 0.84
11 0.76
12 0.73
13 0.66
14 0.59
15 0.57
16 0.48
17 0.47
18 0.44
19 0.44
20 0.43
21 0.44
22 0.44
23 0.43
24 0.47
25 0.49
26 0.49
27 0.46
28 0.41
29 0.39
30 0.39
31 0.37
32 0.31
33 0.22
34 0.26
35 0.32
36 0.41
37 0.47
38 0.51
39 0.54
40 0.54
41 0.58
42 0.57
43 0.58
44 0.56
45 0.57
46 0.53
47 0.51
48 0.5
49 0.45
50 0.4
51 0.32
52 0.23
53 0.13
54 0.09
55 0.04
56 0.04
57 0.04
58 0.05
59 0.05
60 0.05
61 0.05
62 0.04
63 0.04
64 0.04
65 0.05
66 0.04
67 0.04
68 0.04
69 0.04
70 0.04
71 0.05
72 0.04
73 0.04
74 0.06
75 0.06
76 0.08
77 0.1
78 0.1
79 0.12
80 0.19
81 0.22
82 0.26
83 0.27
84 0.29
85 0.3
86 0.34
87 0.43
88 0.42
89 0.45
90 0.42
91 0.45
92 0.44
93 0.49
94 0.53
95 0.54
96 0.54
97 0.56
98 0.58
99 0.58
100 0.58
101 0.57
102 0.55
103 0.54
104 0.51
105 0.51
106 0.53
107 0.53
108 0.54
109 0.55
110 0.59
111 0.6
112 0.58
113 0.57
114 0.51
115 0.49
116 0.47
117 0.4
118 0.35
119 0.29
120 0.32
121 0.33
122 0.32
123 0.33
124 0.36
125 0.34