Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0W4ZK44

Protein Details
Accession A0A0W4ZK44    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
170-194TILEQRKKETQIRQKRKAVWVQIPNHydrophilic
NLS Segment(s)
PositionSequence
147-163RGKGRMSIRRRPRAHIK
Subcellular Location(s) mito 23, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001063  Ribosomal_L22  
IPR018260  Ribosomal_L22/L17_CS  
IPR036394  Ribosomal_L22/L17_sf  
IPR005727  Ribosomal_L22_bac/chlpt-type  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0019843  F:rRNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00237  Ribosomal_L22  
PROSITE View protein in PROSITE  
PS00464  RIBOSOMAL_L22  
Amino Acid Sequences MIKVFNPFFSFCFSTIQSNFFPRYFNNLTRNVIYKKNNHHLSVVSDIFDQKLYKPPTIKETMVIYKSPNMKTSPKKLTKIAKQIAGKKLEDAILQMDFSKKKAARSVAEFLRNARVKAVNNKLDKNTLFVDQALVGKGIYIKQPWFRGKGRMSIRRRPRAHIKMIIRDITILEQRKKETQIRQKRKAVWVQIPNKPIYNKAIGFTC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.31
3 0.34
4 0.3
5 0.32
6 0.35
7 0.31
8 0.31
9 0.25
10 0.33
11 0.35
12 0.39
13 0.41
14 0.42
15 0.46
16 0.47
17 0.52
18 0.47
19 0.49
20 0.48
21 0.5
22 0.54
23 0.6
24 0.63
25 0.58
26 0.57
27 0.51
28 0.48
29 0.47
30 0.38
31 0.29
32 0.24
33 0.22
34 0.21
35 0.2
36 0.17
37 0.12
38 0.2
39 0.22
40 0.25
41 0.28
42 0.3
43 0.35
44 0.4
45 0.39
46 0.33
47 0.35
48 0.36
49 0.35
50 0.34
51 0.28
52 0.28
53 0.34
54 0.32
55 0.3
56 0.28
57 0.34
58 0.4
59 0.47
60 0.53
61 0.54
62 0.56
63 0.61
64 0.66
65 0.67
66 0.7
67 0.65
68 0.62
69 0.6
70 0.64
71 0.63
72 0.58
73 0.5
74 0.4
75 0.37
76 0.31
77 0.25
78 0.18
79 0.13
80 0.09
81 0.09
82 0.09
83 0.1
84 0.1
85 0.1
86 0.16
87 0.15
88 0.17
89 0.22
90 0.25
91 0.25
92 0.3
93 0.35
94 0.33
95 0.36
96 0.34
97 0.31
98 0.36
99 0.34
100 0.29
101 0.26
102 0.25
103 0.23
104 0.31
105 0.38
106 0.37
107 0.4
108 0.43
109 0.42
110 0.44
111 0.41
112 0.36
113 0.29
114 0.24
115 0.21
116 0.18
117 0.17
118 0.13
119 0.14
120 0.11
121 0.1
122 0.07
123 0.07
124 0.08
125 0.08
126 0.09
127 0.1
128 0.12
129 0.17
130 0.25
131 0.28
132 0.33
133 0.35
134 0.41
135 0.42
136 0.48
137 0.53
138 0.56
139 0.6
140 0.65
141 0.72
142 0.75
143 0.75
144 0.74
145 0.75
146 0.74
147 0.75
148 0.74
149 0.71
150 0.7
151 0.73
152 0.67
153 0.56
154 0.48
155 0.4
156 0.35
157 0.35
158 0.32
159 0.31
160 0.32
161 0.36
162 0.4
163 0.45
164 0.49
165 0.53
166 0.57
167 0.64
168 0.71
169 0.78
170 0.81
171 0.83
172 0.85
173 0.83
174 0.82
175 0.8
176 0.79
177 0.78
178 0.77
179 0.74
180 0.68
181 0.65
182 0.57
183 0.52
184 0.47
185 0.46
186 0.4